Serratia plymuthica S13: M621_04135 Help Entry M621_04135        CDS       T02716                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sry  Serratia plymuthica S13 Pathway sry00998   Biosynthesis of various antibiotics sry01100   Metabolic pathways sry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M621_04135    00074 Mycolic acid biosynthesis     M621_04135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M621_04135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGP43104 UniProt:  S4YEJ0 LinkDB All DBs Position 891559..891810 Genome browser AA seq 83 aa AA seqDB search MDKQAIYLQIQALLVKLFELDADDIKPESRLYEELELDSIDAVDLVVHLQKTTGKKIKPE MFKSVRTVQDVVDAIDELLKSDS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggataagcaagctatttacctgcaaattcaggcgctgctggtcaaactgtttgaactg gatgctgatgatattaaaccggaatctcgcctttacgaagagctggagctggacagcatt gatgcggtagatctggtggtgcatctgcagaaaaccaccggcaagaagattaagccggaa atgttcaagtcggtgcgtaccgtgcaggatgtggttgacgctatcgatgaactgctgaaa tcagacagttaa

DBGET integrated database retrieval system