Serratia plymuthica S13: M621_06410 Help Entry M621_06410        CDS       T02716                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism sry  Serratia plymuthica S13 Pathway sry00190   Oxidative phosphorylation sry01100   Metabolic pathways sry02020   Two-component system Module sry_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:sry00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     M621_06410  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     M621_06410 Enzymes [BR:sry01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      M621_06410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AGP43478 UniProt:  S4YL34 LinkDB All DBs Position 1359063..1359176 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEHHEDSKAQQDGK NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattctcggaacgcttcttgcctgcgccttcggcatcatcacg gcgctggcgcttgagcatcacgaagattcaaaagcgcagcaagacggcaagtga

DBGET integrated database retrieval system