Serratia plymuthica S13: M621_16225 Help Entry M621_16225        CDS       T02716                                  Name (GenBank) hypothetical protein   KO K03671   thioredoxin Organism sry  Serratia plymuthica S13 Brite KEGG Orthology (KO) [BR:sry00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sry03110]     M621_16225 Chaperones and folding catalysts [BR:sry03110]  Protein folding catalysts   Protein disulfide isomerase    M621_16225 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 HyaE CHS5_N Thioredoxin_6 DUF6568 Motif Other DBs NCBI-ProteinID:  AGP47137 UniProt:  S4YPD0 LinkDB All DBs Position 3397938..3398162 Genome browser AA seq 74 aa AA seqDB search MSEDIFNHFAEQIESDVKVGKVNVDLAPVLTTKYEIWGLPSVLMFKDGQLVQRIPGVKSA GFYQQALSELKKGQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagcgaagacatttttaaccattttgccgagcagattgaaagcgacgtcaaagtcggc aaagtgaatgtggatctggcaccggtgctgaccaccaaatatgaaatttggggcctgccg tccgtactgatgttcaaggatgggcagttggtccagcgtataccgggtgttaaatcggca gggttttatcagcaagcattgtcagagctgaaaaaagggcagtaa

DBGET integrated database retrieval system