Serratia rubidaea: AXX16_3902 Help Entry AXX16_3902        CDS       T04417                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism srz  Serratia rubidaea Pathway srz00190   Oxidative phosphorylation srz01100   Metabolic pathways srz02020   Two-component system Module srz_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:srz00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AXX16_3902  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AXX16_3902 Enzymes [BR:srz01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      AXX16_3902 SSDB OrthologParalogGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AML59591 UniProt:  A0A448S0Q4 LinkDB All DBs Position complement(4204924..4205037) Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEQSEKTKAQQNGE NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattctcggcacgcttcttgcctgcgcttttggcatcatcacg gcgctggcgcttgagcagagcgaaaaaacgaaagcgcagcaaaacggtgaataa

DBGET integrated database retrieval system