Stakelama saccharophila: RPR59_01840
Help
Entry
RPR59_01840 CDS
T10187
Name
(GenBank) Trm112 family protein
KO
K09791
uncharacterized protein
Organism
ssaa Stakelama saccharophila
Brite
KEGG Orthology (KO) [BR:
ssaa00001
]
09190 Not Included in Pathway or Brite
09194 Poorly characterized
99997 Function unknown
RPR59_01840
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Trm112p
Motif
Other DBs
NCBI-ProteinID:
WNO54026
UniProt:
A0ABZ0BBH4
LinkDB
All DBs
Position
complement(381033..381212)
Genome browser
AA seq
59 aa
AA seq
DB search
MTDRREPDPRLLAVLVCPVTRTPLRHDREAGELISERAGLAYPIRDGIPVMLVEEARKL
NT seq
180 nt
NT seq
+upstream
nt +downstream
nt
gtgacggaccggcgcgaacccgatccccgcttgctggcagtgctcgtctgcccggtcacg
cgaacgccgctgcgccatgaccgcgaagccggggaactgatttcggagcgcgccggcctc
gcctatccgatccgggacggcattccggtgatgctggtggaagaagcgcgcaagctgtag
DBGET
integrated database retrieval system