Stakelama saccharophila: RPR59_08125 Help Entry RPR59_08125       CDS       T10187                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssaa  Stakelama saccharophila Pathway ssaa01100   Metabolic pathways ssaa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssaa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RPR59_08125    00074 Mycolic acid biosynthesis     RPR59_08125   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RPR59_08125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Ribosomal_L50 DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  WNO52447 UniProt:  A0ABZ0B4Y8 LinkDB All DBs Position 1757003..1757239 Genome browser AA seq 78 aa AA seqDB search MSETADRVRKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAINYIDEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgatcgggtacgcaagatcgtcgtcgagcatctgggcgtcgaagcc gacaaggtgaccgaggatgccagcttcatcgacgatctgggcgcggacagccttgacatc gtcgagctggtcatggcgttcgaggaagaattcggcgtcgagattccggacgacgccgcg gagaagatcacgaccgtcaaggacgcgatcaactacatcgacgagcacaagggctga

DBGET integrated database retrieval system