Staphylococcus saccharolyticus: I6I31_08275 Help Entry I6I31_08275       CDS       T07353                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssac  Staphylococcus saccharolyticus Pathway ssac01100   Metabolic pathways ssac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I6I31_08275    00074 Mycolic acid biosynthesis     I6I31_08275   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I6I31_08275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  QQB98030 LinkDB All DBs Position 1704045..1704278 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTENASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKYINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagacatcatcgttgaccgtttaggtgtagatgctgac aaagtaactgaaaatgcatctttcaaagatgacttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgaatttggtactgaaattcctgatgaagaagctgaa aaaatcaatactgttggtgatgcagttaaatacatcaacagccttgaaaaataa

DBGET integrated database retrieval system