Sphingomonas sanguinis: KV697_03510 Help Entry KV697_03510       CDS       T09609                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssag  Sphingomonas sanguinis Pathway ssag01100   Metabolic pathways ssag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KV697_03510    00074 Mycolic acid biosynthesis     KV697_03510   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KV697_03510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  QXT36422 LinkDB All DBs Position complement(821579..821815) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVKDAITYIDENKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgccgaccgcgtgaagaagatcgtcgtcgagcatctcggcgtcgaagcc gacaaggtgaccgaggacgcgagcttcatcgacgacctcggtgccgacagcctcgacatc gtcgagctcgtcatggcgttcgaggaagagttcggtgtcgaaatcccggacgatgccgcc gagaagatcacgaccgtcaaggacgcgatcacctatatcgacgagaacaaggcctaa

DBGET integrated database retrieval system