Sphingomonas sanguinis: KV697_09750 Help Entry KV697_09750       CDS       T09609                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism ssag  Sphingomonas sanguinis Pathway ssag00030   Pentose phosphate pathway ssag00051   Fructose and mannose metabolism ssag00710   Carbon fixation by Calvin cycle ssag01100   Metabolic pathways ssag01110   Biosynthesis of secondary metabolites ssag01120   Microbial metabolism in diverse environments ssag01200   Carbon metabolism ssag01230   Biosynthesis of amino acids Module ssag_M00004   Pentose phosphate pathway (Pentose phosphate cycle) ssag_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:ssag00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     KV697_09750 (rpiB)    00051 Fructose and mannose metabolism     KV697_09750 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     KV697_09750 (rpiB) Enzymes [BR:ssag01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      KV697_09750 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB Motif Other DBs NCBI-ProteinID:  QXT37519 LinkDB All DBs Position complement(2092448..2092891) Genome browser AA seq 147 aa AA seqDB search MRIAIASDHAAVSLKVVLADWLREQGHEVLDLGTDGTASVDYPDFGRAIGEALADGRAER GVALCGSGIGISIAANRNPACRCALVSEPLSAALARQHNDANAIAMGARVIGEEMAKACL EAFLSTPFEGGRHQRRVDMLSTAPAQN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgcgcatcgcgatcgcatccgatcatgccgccgtctcgttgaaggtcgtgctggcggac tggctgcgcgaacagggtcatgaggtactggacctggggaccgacgggaccgccagcgtc gactatcccgatttcggccgcgcgatcggcgaagcgctggccgatgggcgcgccgaacgc ggcgtcgcgctgtgcggatcgggcatcggtatctcgatcgcggctaaccgcaaccccgcc tgccgctgcgcgctcgtgtccgagccgctgtcggccgcgctcgcccgtcagcataacgac gccaacgccatcgctatgggcgcgcgcgtcatcggcgaggaaatggccaaggcctgcctc gaagcctttctgtccaccccgttcgagggcggacgtcatcagcgccgtgtcgacatgctg tccactgcgcccgcccagaattga

DBGET integrated database retrieval system