Streptococcus salivarius HSISS4: HSISS4_00309 Help Entry HSISS4_00309      CDS       T04634                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ssah  Streptococcus salivarius HSISS4 Pathway ssah01100   Metabolic pathways ssah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssah00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HSISS4_00309 (acpP)    00074 Mycolic acid biosynthesis     HSISS4_00309 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HSISS4_00309 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB ACP_SdgA_C Csd3_N DUF6137 Motif Other DBs NCBI-ProteinID:  ALR79321 UniProt:  A0A074IY50 LinkDB All DBs Position 347680..347904 Genome browser AA seq 74 aa AA seqDB search MAVFEKVQEIIVEELGKDAEEVKVETTFDELDADSLDVFQVISEIEDEFDIQIETEEGLN TVGDLVAYVEEKTK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaaaaagtacaagaaatcatcgttgaagaacttgggaaagatgcagaa gaagtaaaagtagaaactacttttgacgaacttgacgctgactcacttgacgtgttccaa gttatctcagaaatcgaagatgagttcgatatccaaatcgaaactgaagaaggtcttaac actgttggtgaccttgttgcttacgtagaagaaaaaactaaatga

DBGET integrated database retrieval system