Sphingomonas sanxanigenens: NX02_02435 Help Entry NX02_02435        CDS       T03929                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ssan  Sphingomonas sanxanigenens Pathway ssan01100   Metabolic pathways ssan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NX02_02435    00074 Mycolic acid biosynthesis     NX02_02435   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NX02_02435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AHE52247 UniProt:  W0A700 LinkDB All DBs Position 506022..506261 Genome browser AA seq 79 aa AA seqDB search MEEIAPRVFRIISRQLGVYPDQIALASSFYDDIGVDSLDVLEVVMALEDEFGLTIPDEAA GEVKTVEDAVKLVEAWIAK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaagaaatcgctccccgagttttcaggatcattagccgtcagctcggcgtctatccg gatcagattgcccttgcttcgtctttctacgatgacatcggcgtggatagtctcgatgtg ctggaagttgtgatggcgcttgaagacgaattcggactcactatcccggatgaagccgcc ggtgaggtcaaaacagtagaggatgcggtcaagctggtcgaagcatggatagccaagtga

DBGET integrated database retrieval system