Sphingomonas sanxanigenens: NX02_12615 Help Entry NX02_12615        CDS       T03929                                  Name (GenBank) membrane protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ssan  Sphingomonas sanxanigenens Pathway ssan00190   Oxidative phosphorylation ssan01100   Metabolic pathways ssan02020   Two-component system Module ssan_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ssan00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NX02_12615  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     NX02_12615 Enzymes [BR:ssan01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      NX02_12615 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB PIGBOS1 Motif Other DBs NCBI-ProteinID:  AHE54221 UniProt:  W0AAT8 LinkDB All DBs Position 2599991..2600107 Genome browser AA seq 38 aa AA seqDB search MWYFTWVLGLGLAVGFGILNGIWHEFHLPVEDDAPAGR NT seq 117 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcacctgggtacttggcctcggccttgccgttggcttcgggatcctgaac gggatctggcacgaattccatctgccggtggaggatgacgccccggcaggccgataa

DBGET integrated database retrieval system