Sphingomonas sanxanigenens: NX02_28115 Help Entry NX02_28115        CDS       T03929                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ssan  Sphingomonas sanxanigenens Pathway ssan01100   Metabolic pathways ssan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NX02_28115    00074 Mycolic acid biosynthesis     NX02_28115   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NX02_28115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AHE57205 UniProt:  W0ANC4 LinkDB All DBs Position complement(5896064..5896306) Genome browser AA seq 80 aa AA seqDB search MSESTLETIREIMIDVFDLDDDFELTADTSADDIDEWDSLSHIRLVVAVERQFGIKFKNS EIEGLKNVGELVSVIDGKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtccgaatcgacgcttgaaaccatccgcgagatcatgatcgacgtgttcgatctcgat gacgatttcgagctcaccgcggacacctcggccgacgacatcgacgagtgggacagcctg agccacatccggctggtcgtcgcggtggagcgccagttcgggatcaagttcaagaacagc gaaatcgaagggctcaagaacgtcggtgagctcgtgtcggtgatcgacggcaagctcgga taa

DBGET integrated database retrieval system