Spironucleus salmonicida: 94299829 Help Entry 94299829          CDS       T10465                                  Symbol SS50377_25806 Name (RefSeq) Dynein light chain   KO K10418   dynein light chain LC8-type Organism ssao  Spironucleus salmonicida Pathway ssao04517   IgSF CAM signaling ssao04814   Motor proteins Brite KEGG Orthology (KO) [BR:ssao00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     94299829 (SS50377_25806)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     94299829 (SS50377_25806)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ssao03037]     94299829 (SS50377_25806)    04812 Cytoskeleton proteins [BR:ssao04812]     94299829 (SS50377_25806) Cilium and associated proteins [BR:ssao03037]  Motile cilia and associated proteins   Dynein arm    94299829 (SS50377_25806) Cytoskeleton proteins [BR:ssao04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      94299829 (SS50377_25806) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ectatomin Motif Other DBs NCBI-GeneID:  94299829 NCBI-ProteinID:  XP_067762390 LinkDB All DBs Position 6:complement(<384333..>384602) Genome browser AA seq 89 aa AA seqDB search MSDRQVTVKNADMPEEMQQDAIDAAVQAMERFNIEKDIAAYIKKEFDKKHHPTWHVIVGK NFGSYITHETKRFIYFYVGQLAFLIFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccgccaagtcacagtcaaaaacgccgacatgcccgaggaaatgcagcaggac gccatcgacgctgccgtccaagcgatggagcgtttcaacatcgagaaggatatcgcagca tacatcaagaaggagttcgataagaagcaccaccccacctggcacgtcatcgtgggcaag aacttcggctcttacatcacccacgagaccaagcgtttcatctacttctatgtaggccag cttgccttcctcatcttcaaatccggttga

DBGET integrated database retrieval system