Serratia sarumanii: SSARUM_003141 Help Entry SSARUM_003141     CDS       T10280                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssar  Serratia sarumanii Pathway ssar01100   Metabolic pathways ssar01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssar00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SSARUM_003141    00074 Mycolic acid biosynthesis     SSARUM_003141   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SSARUM_003141 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WGZ61417 LinkDB All DBs Position 3297112..3297372 Genome browser AA seq 86 aa AA seqDB search MLNRDAVMDYILTCLQGIVEGGVEIKPDSDLVNDLGLESIRVLDLLMMLEDELDISIPIN ILLDVRTPEQLLDALRPYLEKNHGTV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgcgatgctgtaatggattatatcctgacgtgtttgcaaggtatcgtcgaa ggcggagtggaaataaaacctgatagcgatctcgtcaatgatcttggcctggaatccatc agagtcctggatctgctgatgatgctggaagatgaattagatatctccattcctatcaat atattgcttgatgtcagaacgcctgagcaactgcttgacgcgctgcgcccttatctggag aaaaaccatgggactgtatga

DBGET integrated database retrieval system