KEGG   Serratia sarumanii: SSARUM_004431
Entry
SSARUM_004431     CDS       T10280                                 
Symbol
tauD
Name
(GenBank) taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
ssar  Serratia sarumanii
Pathway
ssar00430  Taurine and hypotaurine metabolism
ssar00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:ssar00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    SSARUM_004431 (tauD)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SSARUM_004431 (tauD)
Enzymes [BR:ssar01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     SSARUM_004431 (tauD)
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: WGZ62619
LinkDB
Position
complement(4663902..4664750)
AA seq 282 aa
MNERLNITPLGPYIGALVENVELARPLGDGQFEQLYHALLKHQVLFFRNQPITPLQQRDL
AGRFGDLHIHPVYPHATDVEEIIVLDTHDDNPPDNDNWHTDVTFIDNPPLGAILTAKTLP
STGGDTLWASGIAAYEALSAPFRTLLAGLRAEHDFTKSFPEHKHRGSVEEHQRWQQAVQK
NPPLLHPVVRTHPVSGRQALFVNEGFTTRIVDLAPKESDALLNFLFAHITKPEFQVRWRW
QENDVAIWDNRVTQHYANADYLPQRRIMHRATILGDRPFYKA
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaacgaacgtctgaatatcaccccgctggggccttacatcggggcgctggtggaaaac
gtcgagttggcccggccgctgggcgacggccagtttgagcagctttatcacgccttgctg
aagcatcaggtgctgttcttccgcaatcagccgatcaccccgctgcagcagcgcgatctg
gccggccgcttcggcgatctgcatatccatccggtctatccgcacgccaccgacgtggaa
gagatcatcgtgctcgatacccacgacgacaacccgccggacaacgataactggcacacc
gacgtgacctttatcgacaacccgccgctgggggcgatcctgacggccaagaccttgcct
tccaccggcggcgatacgctgtgggccagcggcatcgccgcctacgaggcgctgtcggcg
ccgttcagaacgctgttggcggggctgcgtgcggagcatgacttcaccaagtcgttcccg
gaacacaaacatcgcggcagtgtagaggagcatcagcgctggcaacaggcggtgcagaaa
aacccgccgctgctgcatccggtggtgcgcacccacccggtcagcggccggcaggcgctg
ttcgtcaatgaagggtttaccacgcggatcgtcgatctggcgccgaaagagagcgacgct
ttgctgaacttcctgtttgctcacatcaccaaaccggagtttcaggtgcgctggcgctgg
caggaaaatgacgtggcgatctgggataaccgcgtgacgcagcactacgccaacgcggat
tatctgccgcagcggcgcatcatgcaccgcgcgaccattctgggggataggcctttttac
aaggcctga

DBGET integrated database retrieval system