Sphingomonas sabuli: H8M03_04140 Help Entry H8M03_04140       CDS       T07540                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ssau  Sphingomonas sabuli Pathway ssau00190   Oxidative phosphorylation ssau01100   Metabolic pathways Module ssau_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ssau00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     H8M03_04140  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ssau00194]     H8M03_04140 Photosynthesis proteins [BR:ssau00194]  Photosystem and electron transport system   F-type ATPase [OT]    H8M03_04140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF5671 Motif Other DBs NCBI-ProteinID:  QNM83528 UniProt:  A0A7G9L4H9 LinkDB All DBs Position 821989..822216 Genome browser AA seq 75 aa AA seqDB search MDFASAQVIGAGLAAIGVGAAAIGVGNVFGSFLESALRNPAAADGQQGRLFIGFAAAELL GLIAFAVAMIILYAR NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggatttcgcatcggcacaggttatcggcgctggtctcgcagcgatcggcgttggcgcc gccgccatcggcgtgggcaacgtcttcggctcgttccttgaaagcgcgcttcgcaacccg gcggccgccgacggccagcagggccgcctgttcatcggcttcgccgccgccgaacttctc ggcctgatcgccttcgccgtggcgatgatcatcctttacgcccgctaa

DBGET integrated database retrieval system