KEGG   Sphingomonas sabuli: H8M03_08135
Entry
H8M03_08135       CDS       T07540                                 
Name
(GenBank) LptF/LptG family permease
  KO
K07091  lipopolysaccharide export system permease protein
Organism
ssau  Sphingomonas sabuli
Pathway
ssau02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ssau00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    H8M03_08135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ssau02000]
    H8M03_08135
Transporters [BR:ssau02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    H8M03_08135
SSDB
Motif
Pfam: LptF_LptG
Other DBs
NCBI-ProteinID: QNM82002
UniProt: A0A7G9L053
LinkDB
Position
1637167..1638366
AA seq 399 aa
MRGLSLIDRYLARSIAVPLLGTLVLAAMLLVLDKMLRLFDFVVNTGGPVSVVWRMLANLL
PEYFALGIPIGLLLGILLAFRKLALSSELDALRGVGAGFGRLLRVPYLYAFGLILLNAFI
VGYIEPYSNYRYEGLRFDLRSGALGASIKVGEFNRFGKRLTLRIDKSEERGTRLGGIFVQ
VDNPSGESVAATAEAGRFLSTDDPQVILFRLHNGRLIQNSPKFTTPRTLTFKTYDLPIPV
PAIDQFRGRGSEFDELFFNELFRLGYGGGARDREQMLGAQANFHFRIVEILMMAMLPLLA
VALAVPPKRSTSALGIFVGIVMVVAYHKINQYGESAGAQGRIDPILALWVPLLLMGSLIG
WMYHVIAHRPGGQPIGALEWAAGRAARRIRALFPSARVT
NT seq 1200 nt   +upstreamnt  +downstreamnt
ttgcgcggtttgtcgctaatcgaccgctacctggcacggtccatcgcggtgcccttgctg
ggcacgctggtgcttgcggccatgctgttggtgctcgacaagatgctccggctgttcgat
ttcgtcgtcaacaccggcggcccggtcagcgtcgtgtggcggatgctcgccaatctgctg
cccgaatatttcgcgctcggcattcccatcggcctgctgcttggcatcctgctcgccttc
cgcaagctggcgctaagttcggagctggacgcgttgcgcggggtcggcgcgggctttggc
cggctgctgcgcgtgccctatctgtacgcgttcggcctcatcctgctgaacgccttcatc
gtcggctacatcgagccctattccaactaccgctacgaagggctgcgcttcgatctccgg
tccggcgcgctgggggcgtcgatcaaggttggggaattcaaccgcttcggcaagcggctg
accctgcgcatcgacaagagcgaggaacgcggcacccggctcggcgggattttcgtgcag
gtcgacaatccgtcgggcgaatccgtcgccgccaccgccgaagccggccgcttcctgtcg
accgacgacccgcaggtgatcctgttccggctgcataacgggcggctgatccagaattcg
cccaagttcaccacgccgcggacgctgaccttcaagacctacgatctgcccatcccggtg
ccggcgatcgaccagttccgcggccgcggcagcgagttcgacgagctgttcttcaacgag
ctgttccgcctcggctatggcggcggcgcgagggaccgcgagcagatgctcggcgcgcag
gccaatttccatttccggatcgtcgaaatcctgatgatggcgatgctgccgctgctggcc
gtcgcgctggccgtgccgcccaagcgcagcacgtcggcgctgggcatctttgtcggcatc
gtgatggtcgtcgcctatcacaagatcaatcagtacggggaatccgccggggcgcagggg
cgcatcgacccgatcctcgcgctatgggtcccgttgctgctcatgggcagcctgatcggc
tggatgtaccacgtcatcgcccatcgtccgggcgggcagccgatcggcgcgctggaatgg
gccgccggccgcgccgcccgccgcatccgcgctctcttcccaagtgcgcgcgtcacatga

DBGET integrated database retrieval system