Sphingomonas sabuli: H8M03_08135
Help
Entry
H8M03_08135 CDS
T07540
Name
(GenBank) LptF/LptG family permease
KO
K07091
lipopolysaccharide export system permease protein
Organism
ssau
Sphingomonas sabuli
Pathway
ssau02010
ABC transporters
Brite
KEGG Orthology (KO) [BR:
ssau00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
H8M03_08135
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
ssau02000
]
H8M03_08135
Transporters [BR:
ssau02000
]
ABC transporters, prokaryotic type
ABC-2 type and other transporters
Lipopolysaccharide transporter
H8M03_08135
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LptF_LptG
Motif
Other DBs
NCBI-ProteinID:
QNM82002
UniProt:
A0A7G9L053
LinkDB
All DBs
Position
1637167..1638366
Genome browser
AA seq
399 aa
AA seq
DB search
MRGLSLIDRYLARSIAVPLLGTLVLAAMLLVLDKMLRLFDFVVNTGGPVSVVWRMLANLL
PEYFALGIPIGLLLGILLAFRKLALSSELDALRGVGAGFGRLLRVPYLYAFGLILLNAFI
VGYIEPYSNYRYEGLRFDLRSGALGASIKVGEFNRFGKRLTLRIDKSEERGTRLGGIFVQ
VDNPSGESVAATAEAGRFLSTDDPQVILFRLHNGRLIQNSPKFTTPRTLTFKTYDLPIPV
PAIDQFRGRGSEFDELFFNELFRLGYGGGARDREQMLGAQANFHFRIVEILMMAMLPLLA
VALAVPPKRSTSALGIFVGIVMVVAYHKINQYGESAGAQGRIDPILALWVPLLLMGSLIG
WMYHVIAHRPGGQPIGALEWAAGRAARRIRALFPSARVT
NT seq
1200 nt
NT seq
+upstream
nt +downstream
nt
ttgcgcggtttgtcgctaatcgaccgctacctggcacggtccatcgcggtgcccttgctg
ggcacgctggtgcttgcggccatgctgttggtgctcgacaagatgctccggctgttcgat
ttcgtcgtcaacaccggcggcccggtcagcgtcgtgtggcggatgctcgccaatctgctg
cccgaatatttcgcgctcggcattcccatcggcctgctgcttggcatcctgctcgccttc
cgcaagctggcgctaagttcggagctggacgcgttgcgcggggtcggcgcgggctttggc
cggctgctgcgcgtgccctatctgtacgcgttcggcctcatcctgctgaacgccttcatc
gtcggctacatcgagccctattccaactaccgctacgaagggctgcgcttcgatctccgg
tccggcgcgctgggggcgtcgatcaaggttggggaattcaaccgcttcggcaagcggctg
accctgcgcatcgacaagagcgaggaacgcggcacccggctcggcgggattttcgtgcag
gtcgacaatccgtcgggcgaatccgtcgccgccaccgccgaagccggccgcttcctgtcg
accgacgacccgcaggtgatcctgttccggctgcataacgggcggctgatccagaattcg
cccaagttcaccacgccgcggacgctgaccttcaagacctacgatctgcccatcccggtg
ccggcgatcgaccagttccgcggccgcggcagcgagttcgacgagctgttcttcaacgag
ctgttccgcctcggctatggcggcggcgcgagggaccgcgagcagatgctcggcgcgcag
gccaatttccatttccggatcgtcgaaatcctgatgatggcgatgctgccgctgctggcc
gtcgcgctggccgtgccgcccaagcgcagcacgtcggcgctgggcatctttgtcggcatc
gtgatggtcgtcgcctatcacaagatcaatcagtacggggaatccgccggggcgcagggg
cgcatcgacccgatcctcgcgctatgggtcccgttgctgctcatgggcagcctgatcggc
tggatgtaccacgtcatcgcccatcgtccgggcgggcagccgatcggcgcgctggaatgg
gccgccggccgcgccgcccgccgcatccgcgctctcttcccaagtgcgcgcgtcacatga
DBGET
integrated database retrieval system