KEGG   Sphingomonas sabuli: H8M03_11195
Entry
H8M03_11195       CDS       T07540                                 
Symbol
aac(3)-I
Name
(GenBank) AAC(3)-I family aminoglycoside N-acetyltransferase
  KO
K03395  aminoglycoside 3-N-acetyltransferase I [EC:2.3.1.60]
Organism
ssau  Sphingomonas sabuli
Brite
KEGG Orthology (KO) [BR:ssau00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ssau01504]
    H8M03_11195 (aac(3)-I)
Enzymes [BR:ssau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.60  gentamicin 3-N-acetyltransferase
     H8M03_11195 (aac(3)-I)
Antimicrobial resistance genes [BR:ssau01504]
 Gene variants
  Aminoglycoside resistance genes
   N-Acetyltransferases
    H8M03_11195 (aac(3)-I)
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 FR47 Acetyltransf_9 Acetyltransf_10 Acetyltransf_CG Acetyltransf_3 Acetyltransf_8 Rv0428c_C Acetyltransf_6 Acetyltransf_15 GNAT_acetyltran PanZ Acetyltransf_13 ApbA_C
Other DBs
NCBI-ProteinID: QNM82555
UniProt: A0A7G9L1Q6
LinkDB
Position
2235366..2235818
AA seq 150 aa
MSGVKVRRLVPADIRVMQDMSRMFAAAFDEPETYARPPRAAYLDRLLGNPGFVALAALHD
GEVVGGLIAYELVKYERERSEFYIYDLAVAEEHRRRGIATALIAEVCRIAAANDAEVVFV
QADHGDDAAIALYTKLGTREDVMHFDIPAR
NT seq 453 nt   +upstreamnt  +downstreamnt
atgagcggtgtcaaggtccggcggctggtgccggcggacatccgcgtcatgcaggacatg
tcgcgcatgttcgccgcggcgttcgacgagccggagacttatgcccggccgccgcgcgcg
gcctatctcgaccggctgctcggtaaccccggcttcgtcgcgcttgccgccttgcacgac
ggggaggtcgtcggcggcctgatcgcctatgagcttgttaaatatgagcgcgagcgcagc
gaattctacatctacgaccttgccgtggcggaggagcatcgccggcgcggcattgccacc
gcgctgatcgccgaggtctgccgcatcgccgcggccaacgacgcggaggtcgtgttcgtc
caggccgaccatggcgacgatgcggcgatcgcgctctacaccaagctcggcacccgcgag
gacgtgatgcatttcgacattcccgcgcgttga

DBGET integrated database retrieval system