Sphingomonas sabuli: H8M03_12310 Help Entry H8M03_12310       CDS       T07540                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssau  Sphingomonas sabuli Pathway ssau01100   Metabolic pathways ssau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H8M03_12310    00074 Mycolic acid biosynthesis     H8M03_12310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H8M03_12310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 DUF5783 HLH Motif Other DBs NCBI-ProteinID:  QNM82751 UniProt:  A0A7G9L2A2 LinkDB All DBs Position 2459399..2459635 Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFNVEIPDDAA EKIATVKDAIDYIDQNQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagactgccgatcgggttaagaagatcgttgtcgagcacctcggcgtcgaagcc gacaaggtgaccgaagaagccagcttcatcgacgatctcggcgccgacagcctcgacatc gtcgagctggtcatggctttcgaagaagagttcaacgtcgagattccggacgatgccgcc gagaagatcgcgacggtcaaggacgccatcgactatatcgaccagaaccagggttaa

DBGET integrated database retrieval system