Sus scrofa (pig): 100144499 Help Entry 100144499         CDS       T01009                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism ssc  Sus scrofa (pig) Pathway ssc04014   Ras signaling pathway ssc04137   Mitophagy - animal ssc04144   Endocytosis ssc04145   Phagosome ssc04148   Efferocytosis ssc04962   Vasopressin-regulated water reabsorption ssc05014   Amyotrophic lateral sclerosis ssc05022   Pathways of neurodegeneration - multiple diseases ssc05132   Salmonella infection ssc05146   Amoebiasis ssc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100144499 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100144499 (RAB5A)    04145 Phagosome     100144499 (RAB5A)    04137 Mitophagy - animal     100144499 (RAB5A)    04148 Efferocytosis     100144499 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100144499 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100144499 (RAB5A)    05152 Tuberculosis     100144499 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100144499 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100144499 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     100144499 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     100144499 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssc04147]     100144499 (RAB5A)    04031 GTP-binding proteins [BR:ssc04031]     100144499 (RAB5A) Membrane trafficking [BR:ssc04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100144499 (RAB5A)  Endosome - Lysosome transport     100144499 (RAB5A) Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100144499 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    100144499 (RAB5A)   Exosomal proteins of colorectal cancer cells    100144499 (RAB5A)   Exosomal proteins of bladder cancer cells    100144499 (RAB5A) GTP-binding proteins [BR:ssc04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100144499 (RAB5A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta BrnT_toxin Motif Other DBs NCBI-GeneID:  100144499 NCBI-ProteinID:  NP_001116652 Ensembl:  ENSSSCG00000029497 UniProt:  Q06AU6 LinkDB All DBs Position 13:6905302..6940165 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGINCTRGRGVDLTEPTQPTRSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag tttaaactagtacttctgggagagtctgctgttggcaaatcaagcctagtgcttcgtttt gtgaagggccaatttcatgaatttcaagagagtaccattggggctgcttttctaactcaa accgtgtgtcttgatgacacaacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgccagagccaaaaactgggttaaagaacttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggctgacctcgcaaataaa agagctgtcgatttccaggaagcacagtcctatgcagatgacaacagtttattatttatg gaaacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaatgaaccacagaatccaggaataaattgtaccagaggaagaggagtagac cttactgaacccacgcagccaaccaggagtcagtgttgtagtaattaa

DBGET integrated database retrieval system