Sus scrofa (pig): 100144768 Help Entry 100144768         CDS       T01009                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism ssc  Sus scrofa (pig) Pathway ssc04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100144768 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ssc03037]     100144768 (CBY1) Cilium and associated proteins [BR:ssc03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    100144768 (CBY1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Chibby Motif Other DBs NCBI-GeneID:  100144768 NCBI-ProteinID:  NP_001121928 Ensembl:  ENSSSCG00000024599 UniProt:  A0A8D1VDW1 B2CAW6 LinkDB All DBs Position 5:complement(9346087..9358155) Genome browser AA seq 127 aa AA seqDB search MPLFGSTFSPKKTPPRKSASLSNLHNLDRSTREVELGLDYGTPTMNLAGQSLKFENGQWI AESGISGGVDRREAQRLRRRNQQLEEENNLLRLKVDILLDMLSETTAESHLMEKELDELK GVSQRRK NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgcctctctttgggagtacgttcagtccgaagaagacgccccctcggaagtccgcctcg ctctccaacctgcataatttggatcgttcaacccgggaggtggagctgggccttgactac ggaacccccactatgaacctggcggggcaaagcctgaagtttgaaaatggccagtggata gcagagtcggggattagtggaggcgtggaccggagggaggctcagcgcctccggaggcgg aaccagcagttggaggaagagaacaatctcttacggctcaaggtggacatcctgctagac atgctctccgagaccactgccgaatcccacttaatggagaaggagctggatgaactgaag ggtgtcagtcagcggagaaaatga

DBGET integrated database retrieval system