Sus scrofa (pig): 100153325 Help Entry 100153325         CDS       T01009                                  Name (RefSeq) interferon alpha-2 precursor   KO K05414   interferon alpha Organism ssc  Sus scrofa (pig) Pathway ssc04060   Cytokine-cytokine receptor interaction ssc04151   PI3K-Akt signaling pathway ssc04217   Necroptosis ssc04620   Toll-like receptor signaling pathway ssc04621   NOD-like receptor signaling pathway ssc04622   RIG-I-like receptor signaling pathway ssc04623   Cytosolic DNA-sensing pathway ssc04630   JAK-STAT signaling pathway ssc04650   Natural killer cell mediated cytotoxicity ssc04936   Alcoholic liver disease ssc05152   Tuberculosis ssc05160   Hepatitis C ssc05161   Hepatitis B ssc05162   Measles ssc05163   Human cytomegalovirus infection ssc05164   Influenza A ssc05165   Human papillomavirus infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05168   Herpes simplex virus 1 infection ssc05169   Epstein-Barr virus infection ssc05170   Human immunodeficiency virus 1 infection ssc05171   Coronavirus disease - COVID-19 ssc05200   Pathways in cancer ssc05320   Autoimmune thyroid disease ssc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100153325    04151 PI3K-Akt signaling pathway     100153325   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100153325  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100153325  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100153325    04621 NOD-like receptor signaling pathway     100153325    04622 RIG-I-like receptor signaling pathway     100153325    04623 Cytosolic DNA-sensing pathway     100153325    04650 Natural killer cell mediated cytotoxicity     100153325  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100153325   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100153325    05161 Hepatitis B     100153325    05160 Hepatitis C     100153325    05171 Coronavirus disease - COVID-19     100153325    05164 Influenza A     100153325    05162 Measles     100153325    05168 Herpes simplex virus 1 infection     100153325    05163 Human cytomegalovirus infection     100153325    05167 Kaposi sarcoma-associated herpesvirus infection     100153325    05169 Epstein-Barr virus infection     100153325    05165 Human papillomavirus infection     100153325   09171 Infectious disease: bacterial    05152 Tuberculosis     100153325   09163 Immune disease    05320 Autoimmune thyroid disease     100153325   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100153325   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100153325  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssc04052]     100153325 Cytokines and neuropeptides [BR:ssc04052]  Cytokines   Interferons    100153325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100153325 NCBI-ProteinID:  NP_001123691 Ensembl:  ENSSSCG00000030966 Vega:  OTTSUSG00000001445 UniProt:  A0A4X1WC40 Q304W0 LinkDB All DBs Position 1:complement(201272569..201273114) Genome browser AA seq 181 aa AA seqDB search MAPTSAFLTALVLLSCNAICCLGCDLPQTHSLAHTRALRLLAQMRRISPFSCLDHRRDFG FPQEALGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWDESLLHQFCTGLDQQLRDLE ACVMQEAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRAFSSSRN L NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggccccaacctcagccttcctcacagccctggtgctactcagctgcaatgccatctgc tgtctgggctgcgacctgcctcagacccacagcctggctcacaccagggccctgaggctc ctggcacaaatgaggagaatctcccccttctcctgcctggaccacagaagggactttgga ttcccccaagaggccttggggggcaaccaggtccagaaggctcaagccatggctctggtg catgagatgctccagcagaccttccagctcttcagcacagagggctcggctgctgcctgg gatgagagcctcctgcaccagttctgcactggactggatcagcagctcagggacctggaa gcctgtgtcatgcaggaggcggggctggaagggacccccctgctggaggaggactccatc ctggctgtgaggaaatacttccacagactcaccctctatctgcaagagaagagctacagc ccctgtgcctgggagatcgtcagggcagaagtcatgagagccttctcttcctccagaaac ctgtga

DBGET integrated database retrieval system