Sus scrofa (pig): 100154715 Help Entry 100154715         CDS       T01009                                  Symbol CDK2 Name (RefSeq) cyclin-dependent kinase 2   KO K02206   cyclin-dependent kinase 2 [EC:2.7.11.22] Organism ssc  Sus scrofa (pig) Pathway ssc04068   FoxO signaling pathway ssc04110   Cell cycle ssc04114   Oocyte meiosis ssc04115   p53 signaling pathway ssc04151   PI3K-Akt signaling pathway ssc04218   Cellular senescence ssc04914   Progesterone-mediated oocyte maturation ssc04934   Cushing syndrome ssc05160   Hepatitis C ssc05161   Hepatitis B ssc05162   Measles ssc05165   Human papillomavirus infection ssc05166   Human T-cell leukemia virus 1 infection ssc05169   Epstein-Barr virus infection ssc05200   Pathways in cancer ssc05203   Viral carcinogenesis ssc05215   Prostate cancer ssc05222   Small cell lung cancer ssc05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100154715 (CDK2)    04151 PI3K-Akt signaling pathway     100154715 (CDK2)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100154715 (CDK2)    04114 Oocyte meiosis     100154715 (CDK2)    04115 p53 signaling pathway     100154715 (CDK2)    04218 Cellular senescence     100154715 (CDK2)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     100154715 (CDK2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100154715 (CDK2)    05203 Viral carcinogenesis     100154715 (CDK2)   09162 Cancer: specific types    05226 Gastric cancer     100154715 (CDK2)    05215 Prostate cancer     100154715 (CDK2)    05222 Small cell lung cancer     100154715 (CDK2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100154715 (CDK2)    05161 Hepatitis B     100154715 (CDK2)    05160 Hepatitis C     100154715 (CDK2)    05162 Measles     100154715 (CDK2)    05169 Epstein-Barr virus infection     100154715 (CDK2)    05165 Human papillomavirus infection     100154715 (CDK2)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100154715 (CDK2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ssc01001]     100154715 (CDK2)   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ssc03032]     100154715 (CDK2)    03036 Chromosome and associated proteins [BR:ssc03036]     100154715 (CDK2) Enzymes [BR:ssc01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100154715 (CDK2) Protein kinases [BR:ssc01001]  Serine/threonine kinases: CMGC group   CDK family    100154715 (CDK2) DNA replication proteins [BR:ssc03032]  Eukaryotic type   DNA Replication Initiation Factors    CDK (cyclin dependent kinase)     100154715 (CDK2) Chromosome and associated proteins [BR:ssc03036]  Eukaryotic type   Centrosome formation proteins    Kinases and associated factors     100154715 (CDK2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  100154715 NCBI-ProteinID:  NP_001272394 Ensembl:  ENSSSCG00000000373 UniProt:  A0A8D0IL21 A0A4X1W9I0 LinkDB All DBs Position 5:21365723..21372170 Genome browser AA seq 298 aa AA seqDB search MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS HRVLHRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL NT seq 897 nt NT seq  +upstreamnt  +downstreamnt atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa gccaaaaacaaggtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag acggagggtgtacccagtactgccattcgagagatctctctgcttaaggagcttaaccac cctaatattgtcaagttgctggatgtcattcacacagaaaacaaactctacctggttttt gagtttctgcaccaggatctcaagaaattcatggatgcctctgctctcactggcattcct cttcccctcataaagagttatctgttccagctgcttcaggggctagctttttgccattct catcgggtcttgcaccgagaccttaaacctcagaatctgcttatcaacgcagaaggatct atcaagttagcagactttggactggccagagcctttggagtccctgttcgtacatacacc catgaggtggtgactttgtggtacagagcacctgaaatccttctgggctgcaaatactac tctacagccgtggacatctggagcctgggctgcatctttgctgagatggtgacccgccgg gctctgttccctggagattctgagattgaccagctcttccggatctttcggactctcggg accccagatgaggtggtttggccaggagttacttccatgcctgattataaaccgagtttc cctaagtgggccaggcaagattttagcaaagttgtgcctcccctggatgaagatggacgg agcttgttatcgcaaatgctgcactacgaccccaacaagcggatttcagcaaaggcagct ctggctcaccctttcttccaggatgtgaccaagccagtacctcaccttcgactttga

DBGET integrated database retrieval system