Sus scrofa (pig): 100156561 Help Entry 100156561         CDS       T01009                                  Symbol IFN-ALPHA-10 Name (RefSeq) interferon-alpha-10 precursor   KO K05414   interferon alpha Organism ssc  Sus scrofa (pig) Pathway ssc04060   Cytokine-cytokine receptor interaction ssc04151   PI3K-Akt signaling pathway ssc04217   Necroptosis ssc04620   Toll-like receptor signaling pathway ssc04621   NOD-like receptor signaling pathway ssc04622   RIG-I-like receptor signaling pathway ssc04623   Cytosolic DNA-sensing pathway ssc04630   JAK-STAT signaling pathway ssc04650   Natural killer cell mediated cytotoxicity ssc04936   Alcoholic liver disease ssc05152   Tuberculosis ssc05160   Hepatitis C ssc05161   Hepatitis B ssc05162   Measles ssc05163   Human cytomegalovirus infection ssc05164   Influenza A ssc05165   Human papillomavirus infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05168   Herpes simplex virus 1 infection ssc05169   Epstein-Barr virus infection ssc05170   Human immunodeficiency virus 1 infection ssc05171   Coronavirus disease - COVID-19 ssc05200   Pathways in cancer ssc05320   Autoimmune thyroid disease ssc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100156561 (IFN-ALPHA-10)    04151 PI3K-Akt signaling pathway     100156561 (IFN-ALPHA-10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100156561 (IFN-ALPHA-10)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100156561 (IFN-ALPHA-10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100156561 (IFN-ALPHA-10)    04621 NOD-like receptor signaling pathway     100156561 (IFN-ALPHA-10)    04622 RIG-I-like receptor signaling pathway     100156561 (IFN-ALPHA-10)    04623 Cytosolic DNA-sensing pathway     100156561 (IFN-ALPHA-10)    04650 Natural killer cell mediated cytotoxicity     100156561 (IFN-ALPHA-10)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100156561 (IFN-ALPHA-10)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100156561 (IFN-ALPHA-10)    05161 Hepatitis B     100156561 (IFN-ALPHA-10)    05160 Hepatitis C     100156561 (IFN-ALPHA-10)    05171 Coronavirus disease - COVID-19     100156561 (IFN-ALPHA-10)    05164 Influenza A     100156561 (IFN-ALPHA-10)    05162 Measles     100156561 (IFN-ALPHA-10)    05168 Herpes simplex virus 1 infection     100156561 (IFN-ALPHA-10)    05163 Human cytomegalovirus infection     100156561 (IFN-ALPHA-10)    05167 Kaposi sarcoma-associated herpesvirus infection     100156561 (IFN-ALPHA-10)    05169 Epstein-Barr virus infection     100156561 (IFN-ALPHA-10)    05165 Human papillomavirus infection     100156561 (IFN-ALPHA-10)   09171 Infectious disease: bacterial    05152 Tuberculosis     100156561 (IFN-ALPHA-10)   09163 Immune disease    05320 Autoimmune thyroid disease     100156561 (IFN-ALPHA-10)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100156561 (IFN-ALPHA-10)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100156561 (IFN-ALPHA-10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssc04052]     100156561 (IFN-ALPHA-10) Cytokines and neuropeptides [BR:ssc04052]  Cytokines   Interferons    100156561 (IFN-ALPHA-10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100156561 NCBI-ProteinID:  NP_001159782 Ensembl:  ENSSSCG00000023524 Vega:  OTTSUSG00000001477 UniProt:  Q304V8 LinkDB All DBs Position 1:complement(201353877..201354422) Genome browser AA seq 181 aa AA seqDB search MAPTSAFFTALVLLSCNAICSLGCNLPQTHSLAHTRALRLLAQMRRISPFSCLDHRKDFG FPQEALGGNQVQKAQAMALVHEMLQQTFQLFSTEGSAAAWNESLLHQFCTGLDQQLRDLE ACVMQEAGLEGTPLLEEDSILAVRKYFHRLTLYLQEKSYSPCAWEIVRAEVMRSFSSSRN L NT seq 546 nt NT seq  +upstreamnt  +downstreamnt atggccccaacctcagccttcttcacagccctggtgctgctcagctgcaatgccatctgc tctctgggctgcaacctgcctcagacccacagcctggctcacaccagggccctgaggctc ctggcacaaatgaggagaatctctcccttctcctgcctggaccacagaaaggactttgga ttcccccaagaggccttggggggcaaccaggtccagaaggctcaagccatggctctggtg catgagatgctccagcagaccttccagctcttcagcacagagggctcggctgctgcctgg aatgagagcctcctgcaccagttctgcactggactggatcagcagctcagggacctggaa gcctgtgtcatgcaggaggcggggctggaagggacccccctgctggaggaggactccatc ctggctgtgaggaaatacttccacagactcaccctctatctgcaagagaagagctacagc ccctgtgcctgggagatcgtcagggcagaagtcatgagatccttctcttcctccagaaac ctgtga

DBGET integrated database retrieval system