Sus scrofa (pig): 100462745 Help Entry 100462745         CDS       T01009                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism ssc  Sus scrofa (pig) Pathway ssc04068   FoxO signaling pathway ssc04136   Autophagy - other ssc04140   Autophagy - animal ssc04621   NOD-like receptor signaling pathway ssc04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100462745 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100462745 (ATG12)    04136 Autophagy - other     100462745 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100462745 (ATG12)    04622 RIG-I-like receptor signaling pathway     100462745 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     100462745 (ATG12)    04121 Ubiquitin system [BR:ssc04121]     100462745 (ATG12)    03029 Mitochondrial biogenesis [BR:ssc03029]     100462745 (ATG12) Membrane trafficking [BR:ssc04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     100462745 (ATG12) Ubiquitin system [BR:ssc04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100462745 (ATG12) Mitochondrial biogenesis [BR:ssc03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100462745 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  100462745 NCBI-ProteinID:  NP_001177211 Ensembl:  ENSSSCG00000014220 UniProt:  D7RA34 A0A8D1TFS9 LinkDB All DBs Position 2:complement(119948443..119965702) Genome browser AA seq 140 aa AA seqDB search MAEEPESALQLPPATAAEGDGPTEVSPETATPEPPSSASVSPGTEEPAGDTKKKIDILLK AVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLY ECFGSDGKLVLHYCKSQAWG NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcagaggagccggagtctgcgctgcagctcccgcccgcaactgctgctgagggcgat ggacctacggaggtctccccagaaactgccactccggaacccccttcttccgcttcagtt tcccccggaacagaagaacctgccggtgacaccaagaaaaaaattgacatcctactaaag gctgtgggagacacacctataatgaaaacaaagaaatgggctgtagagcgaacccgaacc atccaaggactcattgacttcatcaaaaagtttcttaaacttgtggcttcagaacagttg tttatttatgtgaatcagtcctttgccccctctccagaccaggaagttggaaccctctat gagtgttttggcagtgatggtaaactggtcctgcattactgcaaatctcaggcttgggga tga

DBGET integrated database retrieval system