Sus scrofa (pig): 100511006 Help Entry 100511006         CDS       T01009                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism ssc  Sus scrofa (pig) Pathway ssc04140   Autophagy - animal ssc04144   Endocytosis ssc04152   AMPK signaling pathway ssc04530   Tight junction ssc04972   Pancreatic secretion ssc05014   Amyotrophic lateral sclerosis ssc05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     100511006 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100511006 (RAB8A)    04140 Autophagy - animal     100511006 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     100511006 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     100511006 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100511006 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     100511006 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     100511006 (RAB8A)    03036 Chromosome and associated proteins [BR:ssc03036]     100511006 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssc04147]     100511006 (RAB8A)    04031 GTP-binding proteins [BR:ssc04031]     100511006 (RAB8A) Membrane trafficking [BR:ssc04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     100511006 (RAB8A)  Autophagy   Other autophagy associated proteins     100511006 (RAB8A) Chromosome and associated proteins [BR:ssc03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     100511006 (RAB8A) Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100511006 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    100511006 (RAB8A)   Exosomal proteins of colorectal cancer cells    100511006 (RAB8A) GTP-binding proteins [BR:ssc04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     100511006 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  100511006 NCBI-ProteinID:  NP_001230731 Ensembl:  ENSSSCG00000013848 UniProt:  A0A4X1UZR3 LinkDB All DBs Position 2:complement(61430680..61450351) Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagcttgatggcaagagaattaaactacag atatgggacacagctggtcaggaacggtttcggacgatcacaaccgcctactacaggggc gcaatgggcatcatgctggtttacgacatcaccaacgagaagtcctttgacaacatccgg aactggattcgaaacattgaggagcatgcgtctgcagacgtcgaaaagatgatacttggg aacaagtgcgacgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctggactatggaatcaagttcatggagaccagcgcgaaggccaacatcaacgtggagaac gcctttttcactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccagggagtcaaaatcacaccggaccagcagaagaggagcagc tttttccgatgtgttcttctgtga

DBGET integrated database retrieval system