Sus scrofa (pig): 100512494 Help Entry 100512494         CDS       T01009                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism ssc  Sus scrofa (pig) Pathway ssc04015   Rap1 signaling pathway ssc04810   Regulation of actin cytoskeleton ssc05014   Amyotrophic lateral sclerosis ssc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100512494 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100512494 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100512494 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100512494 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     100512494 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ssc04812]     100512494 (PFN1)    04147 Exosome [BR:ssc04147]     100512494 (PFN1) Membrane trafficking [BR:ssc04131]  Others   Actin-binding proteins    Others     100512494 (PFN1) Cytoskeleton proteins [BR:ssc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100512494 (PFN1) Exosome [BR:ssc04147]  Exosomal proteins   Proteins found in most exosomes    100512494 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100512494 NCBI-ProteinID:  NP_001231345 Ensembl:  ENSSSCG00000017905 UniProt:  A0A8D0JTL8 LinkDB All DBs Position 12:51962642..51965570 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctaacgcttgggggccagaaatgctctgtgatccgggactcactgctgcag gacggggaatttaccatggatcttcgtaccaagagcactggcggagcccccaccttcaat atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcttcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system