Sus scrofa (pig): 100516050 Help Entry 100516050         CDS       T01009                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ssc  Sus scrofa (pig) Pathway ssc04072   Phospholipase D signaling pathway ssc04140   Autophagy - animal ssc04150   mTOR signaling pathway ssc04151   PI3K-Akt signaling pathway ssc04152   AMPK signaling pathway ssc04211   Longevity regulating pathway ssc04218   Cellular senescence ssc04714   Thermogenesis ssc04910   Insulin signaling pathway ssc04919   Thyroid hormone signaling pathway ssc05163   Human cytomegalovirus infection ssc05165   Human papillomavirus infection ssc05168   Herpes simplex virus 1 infection ssc05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     100516050 (RHEB)    04151 PI3K-Akt signaling pathway     100516050 (RHEB)    04152 AMPK signaling pathway     100516050 (RHEB)    04150 mTOR signaling pathway     100516050 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100516050 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     100516050 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100516050 (RHEB)    04919 Thyroid hormone signaling pathway     100516050 (RHEB)   09149 Aging    04211 Longevity regulating pathway     100516050 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     100516050 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     100516050 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100516050 (RHEB)    05163 Human cytomegalovirus infection     100516050 (RHEB)    05165 Human papillomavirus infection     100516050 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ssc04031]     100516050 (RHEB) GTP-binding proteins [BR:ssc04031]  Small (monomeric) G-proteins   Ras Family    Rheb     100516050 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  100516050 NCBI-ProteinID:  NP_001274775 Ensembl:  ENSSSCG00000016434 UniProt:  F2Z5R2 A0A4X1UNU1 LinkDB All DBs Position 18:5779439..5821839 Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcgctgacgattcagtttgtcgaaggccaatttgttgactcctacgatccaactatagaa aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagac acagctgggcaggatgaatattccatcttccctcagacatactccatagatattaacggt tatatcctcgtgtattctgttacatcaatcaaaagttttgaagtgattaaagtcatccat ggcaaattgttggacatggtggggaaagtgcaaatacctattatgttggtcgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaagcattagcagaatct tggaatgcagcttttttggaatcttctgctaaagaaaatcagactgctgttgatgtcttt agaaggataattttggaggcagaaaaaatcgatggcgctgcttcacaaggcaagtcgtcc tgctcggtgatgtga

DBGET integrated database retrieval system