Sus scrofa (pig): 100516558 Help Entry 100516558         CDS       T01009                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism ssc  Sus scrofa (pig) Pathway ssc04010   MAPK signaling pathway ssc04014   Ras signaling pathway ssc04015   Rap1 signaling pathway ssc04024   cAMP signaling pathway ssc04072   Phospholipase D signaling pathway ssc04137   Mitophagy - animal ssc04140   Autophagy - animal ssc04218   Cellular senescence ssc04360   Axon guidance ssc04371   Apelin signaling pathway ssc04625   C-type lectin receptor signaling pathway ssc04810   Regulation of actin cytoskeleton ssc05132   Salmonella infection ssc05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100516558 (RRAS)    04014 Ras signaling pathway     100516558 (RRAS)    04015 Rap1 signaling pathway     100516558 (RRAS)    04371 Apelin signaling pathway     100516558 (RRAS)    04072 Phospholipase D signaling pathway     100516558 (RRAS)    04024 cAMP signaling pathway     100516558 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100516558 (RRAS)    04137 Mitophagy - animal     100516558 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     100516558 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100516558 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100516558 (RRAS)   09158 Development and regeneration    04360 Axon guidance     100516558 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100516558 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100516558 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ssc04031]     100516558 (RRAS) GTP-binding proteins [BR:ssc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100516558 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Abhydrolase_4 AAA_22 Motif Other DBs NCBI-GeneID:  100516558 NCBI-ProteinID:  XP_003356046 Ensembl:  ENSSSCG00000003183 UniProt:  A0A8D0Q972 F1RHW4 LinkDB All DBs Position 6:complement(54680596..54684714) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLETQRQVPRSEASAFSNSHHVAYFEASAKLRLNVD EAFEQLVRAVRKFQEQELPPSPPSAPRKKDRSCPCILL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggggccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgatccc actattgaagactcctacaccaagatctgcaccgtggatggcgtcccggcccggctggac atcctggacaccgcaggccaggaggagttcggtgccatgcgagagcagtacatgcgcgcc ggccacggcttcctgctggtgtttgccattaatgatcggcagagtttcaacgaggtgggc aagctcttcacgcagatcctccgagtcaaggaccgagatgacttccccatcgtgttggtc gggaacaaggcagatctggagacacagcgtcaggttcccagatccgaagcctcggccttc agcaactcccaccacgtggcctacttcgaggcctcggccaaactgcgcctcaacgtggac gaggcctttgagcagctggtgcgcgccgtccggaagttccaggaacaggagctcccaccc agcccgcccagcgcccccaggaagaaggacaggagctgcccctgcatcctcctgtag

DBGET integrated database retrieval system