Sus scrofa (pig): 100521680 Help Entry 100521680         CDS       T01009                                  Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism ssc  Sus scrofa (pig) Pathway ssc04613   Neutrophil extracellular trap formation ssc05034   Alcoholism ssc05202   Transcriptional misregulation in cancer ssc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ssc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     100521680  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     100521680   09163 Immune disease    05322 Systemic lupus erythematosus     100521680   09165 Substance dependence    05034 Alcoholism     100521680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssc03036]     100521680   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssc04147]     100521680 Chromosome and associated proteins [BR:ssc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     100521680 Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100521680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  100521680 NCBI-ProteinID:  XP_003131242 Ensembl:  ENSSSCG00000017202 UniProt:  Q71LE2 K9IWF3 LinkDB All DBs Position 12:5632326..5634977 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaagtccacgggtgggaaagcgccccgcaaacag ctggccactaaagctgccaggaaaagcgctccctctaccggcggggtgaaaaaacctcat cgctacaggcccgggaccgtcgcgcttcgagaaatccgtcgttaccaaaagtccacggag cttctgatccggaagctgcccttccagaggttggtgagggagatcgcccaggatttcaaa actgacttgaggttccagagcgccgccattggtgcgcttcaggaggctagtgaagcgtac ctggtgggtttatttgaagataccaatctgtgtgccatccacgctaagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system