Sus scrofa (pig): 100625117 Help Entry 100625117         CDS       T01009                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ssc  Sus scrofa (pig) Pathway ssc04010   MAPK signaling pathway ssc04020   Calcium signaling pathway ssc04022   cGMP-PKG signaling pathway ssc04114   Oocyte meiosis ssc04218   Cellular senescence ssc04310   Wnt signaling pathway ssc04360   Axon guidance ssc04370   VEGF signaling pathway ssc04380   Osteoclast differentiation ssc04625   C-type lectin receptor signaling pathway ssc04650   Natural killer cell mediated cytotoxicity ssc04658   Th1 and Th2 cell differentiation ssc04659   Th17 cell differentiation ssc04660   T cell receptor signaling pathway ssc04662   B cell receptor signaling pathway ssc04720   Long-term potentiation ssc04724   Glutamatergic synapse ssc04921   Oxytocin signaling pathway ssc04922   Glucagon signaling pathway ssc04924   Renin secretion ssc05010   Alzheimer disease ssc05014   Amyotrophic lateral sclerosis ssc05020   Prion disease ssc05022   Pathways of neurodegeneration - multiple diseases ssc05031   Amphetamine addiction ssc05152   Tuberculosis ssc05163   Human cytomegalovirus infection ssc05166   Human T-cell leukemia virus 1 infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05170   Human immunodeficiency virus 1 infection ssc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ssc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100625117 (PPP3R2)    04310 Wnt signaling pathway     100625117 (PPP3R2)    04370 VEGF signaling pathway     100625117 (PPP3R2)    04020 Calcium signaling pathway     100625117 (PPP3R2)    04022 cGMP-PKG signaling pathway     100625117 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100625117 (PPP3R2)    04218 Cellular senescence     100625117 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100625117 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     100625117 (PPP3R2)    04660 T cell receptor signaling pathway     100625117 (PPP3R2)    04658 Th1 and Th2 cell differentiation     100625117 (PPP3R2)    04659 Th17 cell differentiation     100625117 (PPP3R2)    04662 B cell receptor signaling pathway     100625117 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     100625117 (PPP3R2)    04921 Oxytocin signaling pathway     100625117 (PPP3R2)    04924 Renin secretion     100625117 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     100625117 (PPP3R2)    04720 Long-term potentiation     100625117 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     100625117 (PPP3R2)    04380 Osteoclast differentiation     100625117 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100625117 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100625117 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     100625117 (PPP3R2)    05163 Human cytomegalovirus infection     100625117 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     100625117 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     100625117 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     100625117 (PPP3R2)    05014 Amyotrophic lateral sclerosis     100625117 (PPP3R2)    05020 Prion disease     100625117 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     100625117 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     100625117 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100625117 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ssc01009]     100625117 (PPP3R2) Protein phosphatases and associated proteins [BR:ssc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100625117 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_9 EH Motif Other DBs NCBI-GeneID:  100625117 NCBI-ProteinID:  XP_003360852 Ensembl:  ENSSSCG00000028206 LinkDB All DBs Position 1:complement(243284383..243285358) Genome browser AA seq 170 aa AA seqDB search MGNEPSNPMEMCSQFDQNEIKQLSKRFKKVDLDSSGTLTMKELMSLPGLQVNPLVQRVFD IFDTDGNGEVDFKEFLVGTSQFSVKGDKEQKLRFAFSIYDMDKDGYISNGELFQVLNMMV GDNLKDWQLQQLVDKTIIALDKDGDGKISFHEFCAVARNLKVHEKLGVIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgagcccagtaacccaatggagatgtgctcccagtttgaccaaaacgaaatt aaacagctgagcaagcggtttaagaaggtggacttggacagttcgggcactctgactatg aaggagctcatgtccctgccggggctgcaggtgaacccgttggtgcagcgagtgttcgac attttcgacacagacggcaacggagaagtggacttcaaggaattcctcgtggggacctcc cagttcagtgtcaagggcgacaaggagcagaagctgaggtttgctttcagcatctatgac atggacaaagacggctacatttccaacggggagctcttccaggtgctaaacatgatggtg ggagacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcgccctg gacaaggatggagatgggaaaatatccttccacgaattctgcgctgtggccagaaacctg aaggtccacgagaaattgggggtaattgtgtga

DBGET integrated database retrieval system