Sus scrofa (pig): 100625381 Help Entry 100625381         CDS       T01009                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism ssc  Sus scrofa (pig) Pathway ssc04014   Ras signaling pathway ssc04137   Mitophagy - animal ssc04144   Endocytosis ssc04145   Phagosome ssc04148   Efferocytosis ssc04962   Vasopressin-regulated water reabsorption ssc05132   Salmonella infection ssc05146   Amoebiasis ssc05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100625381 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100625381 (RAB5B)    04145 Phagosome     100625381 (RAB5B)    04137 Mitophagy - animal     100625381 (RAB5B)    04148 Efferocytosis     100625381 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100625381 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100625381 (RAB5B)    05152 Tuberculosis     100625381 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100625381 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     100625381 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssc04147]     100625381 (RAB5B)    04031 GTP-binding proteins [BR:ssc04031]     100625381 (RAB5B) Membrane trafficking [BR:ssc04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100625381 (RAB5B)  Endosome - Lysosome transport     100625381 (RAB5B) Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100625381 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    100625381 (RAB5B)   Exosomal proteins of colorectal cancer cells    100625381 (RAB5B)   Exosomal proteins of melanoma cells    100625381 (RAB5B) GTP-binding proteins [BR:ssc04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100625381 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 MCR_beta Motif Other DBs NCBI-GeneID:  100625381 NCBI-ProteinID:  XP_020947454 Ensembl:  ENSSSCG00000029828 UniProt:  A0A8D0PBZ2 LinkDB All DBs Position 5:21373333..21392729 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNTLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaagttggtcttactgggtgaatctgcagtagggaagtctagcctggtattacgtttt gtcaaaggacagttccacgagtaccaggagagcaccattggagcggccttcctcacccag tctgtttgtctagatgacacaacagtcaagtttgagatctgggacacagctgggcaagag cgataccatagcttggcccccatgtactacagaggtgcccaggctgcaattgtggtttat gacattactaatcaggaaacctttgcccgagcgaagacatgggtaaaggaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagcggacctggccaacaag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacaccttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat ctccatgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system