Sus scrofa (pig): 106508714 Help Entry 106508714         CDS       T01009                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism ssc  Sus scrofa (pig) Pathway ssc04015   Rap1 signaling pathway ssc04810   Regulation of actin cytoskeleton ssc05014   Amyotrophic lateral sclerosis ssc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     106508714 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     106508714 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106508714 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     106508714 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     106508714 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ssc04812]     106508714 (PFN3)    04147 Exosome [BR:ssc04147]     106508714 (PFN3) Membrane trafficking [BR:ssc04131]  Others   Actin-binding proteins    Others     106508714 (PFN3) Cytoskeleton proteins [BR:ssc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      106508714 (PFN3) Exosome [BR:ssc04147]  Exosomal proteins   Proteins found in most exosomes    106508714 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  106508714 NCBI-ProteinID:  XP_013847647 UniProt:  K4IWU4 A0A4X1SF04 LinkDB All DBs Position 2:80545495..80546524 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLIGPDRRTFL QAGLSVAGRRCCVIRDHLLAEGDCVLDARTKGLDGRAVCVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaaggctacattagtgcagtgctgcgggaccagcgcatcgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcatcgcggcccgggggcctgctg gcagccatctcaccgcaggaggtgggtgtgctcatagggccagatcggcgcaccttcctg caggcgggcctgagcgtagcgggccgccgatgctgcgtcatccgcgaccacctgctggct gagggcgactgcgtgctggacgcacgcaccaaagggttggacgggcgcgcggtctgcgtg ggccacacgccgcgcgcgctcctagtgcttatgggccggcgtggcgtgcacggaggcatt ctcaacaagaccatgcacgagctgatccatgggctgcgctctcagggcacctag

DBGET integrated database retrieval system