Sus scrofa (pig): 110261487 Help Entry 110261487         CDS       T01009                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism ssc  Sus scrofa (pig) Pathway ssc04613   Neutrophil extracellular trap formation ssc05034   Alcoholism ssc05203   Viral carcinogenesis ssc05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ssc00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110261487  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110261487   09163 Immune disease    05322 Systemic lupus erythematosus     110261487   09165 Substance dependence    05034 Alcoholism     110261487  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssc03036]     110261487 Chromosome and associated proteins [BR:ssc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110261487 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  110261487 NCBI-ProteinID:  XP_020954094 UniProt:  P62802 A0A480TD90 LinkDB All DBs Position 7:20887263..20887709 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgaggcaagggtggcaaaggactaggtaaagggggcgccaagcgccaccgc aaggtgctgcgagataacatccagggcatcaccaagcccgccatccggcgcctggcccgg cgtggcggcgtcaagcgcatctccggcctcatctacgaggagacccgcggggtgctgaag gtgttcctggagaacgtgatccgggacgccgtcacctacaccgagcacgccaagcgcaag accgtcacggccatggacgtggtctacgcgctcaagcgccagggacgcaccctctacggc ttcggcggttaa

DBGET integrated database retrieval system