Sus scrofa (pig): 396866 Help Entry 396866            CDS       T01009                                  Name (RefSeq) cystatin-A1   KO K13907   cystatin-A/B Organism ssc  Sus scrofa (pig) Brite KEGG Orthology (KO) [BR:ssc00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:ssc01002]     396866   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssc04147]     396866 Peptidases and inhibitors [BR:ssc01002]  Peptidase inhibitors   Family I25: cystatin family    396866 Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    396866 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light Motif Other DBs NCBI-GeneID:  396866 NCBI-ProteinID:  NP_999024 Ensembl:  ENSSSCG00000028871 UniProt:  Q28988 LinkDB All DBs Position 13:complement(138182389..138190473) Genome browser AA seq 103 aa AA seqDB search MESDKMMPGGLTEARPATPEIQEIATTVKSQLEEKTNKTYEKFEAVEYKSQVVAGINYYI KVHVGGNSYVHIKVFKSLPYQNKPLELSGYQVDKTKDDELTGF NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggaatcagacaaaatgatgcctgggggcttaactgaagccagacctgccactccagaa atccaggagattgccaccacggttaaatcacagcttgaagaaaaaacaaataaaacttat gaaaaatttgaagctgttgagtacaaatctcaagtggttgctggaataaattactacatc aaggttcatgtaggtggtaatagctacgttcacataaaagtatttaaaagtcttccttac caaaataagcctttggagcttagtggctaccaggttgacaaaaccaaggatgatgagctg accggcttttag

DBGET integrated database retrieval system