Sus scrofa (pig): 396880 Help Entry 396880            CDS       T01009                                  Symbol CXCL8 Name (RefSeq) interleukin-8 precursor   KO K10030   interleukin 8 Organism ssc  Sus scrofa (pig) Pathway ssc04060   Cytokine-cytokine receptor interaction ssc04061   Viral protein interaction with cytokine and cytokine receptor ssc04062   Chemokine signaling pathway ssc04064   NF-kappa B signaling pathway ssc04072   Phospholipase D signaling pathway ssc04218   Cellular senescence ssc04620   Toll-like receptor signaling pathway ssc04621   NOD-like receptor signaling pathway ssc04622   RIG-I-like receptor signaling pathway ssc04657   IL-17 signaling pathway ssc04932   Non-alcoholic fatty liver disease ssc04933   AGE-RAGE signaling pathway in diabetic complications ssc04936   Alcoholic liver disease ssc05132   Salmonella infection ssc05133   Pertussis ssc05134   Legionellosis ssc05135   Yersinia infection ssc05142   Chagas disease ssc05144   Malaria ssc05146   Amoebiasis ssc05161   Hepatitis B ssc05163   Human cytomegalovirus infection ssc05164   Influenza A ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05171   Coronavirus disease - COVID-19 ssc05200   Pathways in cancer ssc05202   Transcriptional misregulation in cancer ssc05219   Bladder cancer ssc05323   Rheumatoid arthritis ssc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     396880 (CXCL8)    04072 Phospholipase D signaling pathway     396880 (CXCL8)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     396880 (CXCL8)    04061 Viral protein interaction with cytokine and cytokine receptor     396880 (CXCL8)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     396880 (CXCL8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     396880 (CXCL8)    04621 NOD-like receptor signaling pathway     396880 (CXCL8)    04622 RIG-I-like receptor signaling pathway     396880 (CXCL8)    04657 IL-17 signaling pathway     396880 (CXCL8)    04062 Chemokine signaling pathway     396880 (CXCL8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     396880 (CXCL8)    05202 Transcriptional misregulation in cancer     396880 (CXCL8)   09162 Cancer: specific types    05219 Bladder cancer     396880 (CXCL8)   09172 Infectious disease: viral    05161 Hepatitis B     396880 (CXCL8)    05171 Coronavirus disease - COVID-19     396880 (CXCL8)    05164 Influenza A     396880 (CXCL8)    05163 Human cytomegalovirus infection     396880 (CXCL8)    05167 Kaposi sarcoma-associated herpesvirus infection     396880 (CXCL8)   09171 Infectious disease: bacterial    05132 Salmonella infection     396880 (CXCL8)    05135 Yersinia infection     396880 (CXCL8)    05133 Pertussis     396880 (CXCL8)    05134 Legionellosis     396880 (CXCL8)   09174 Infectious disease: parasitic    05146 Amoebiasis     396880 (CXCL8)    05144 Malaria     396880 (CXCL8)    05142 Chagas disease     396880 (CXCL8)   09163 Immune disease    05323 Rheumatoid arthritis     396880 (CXCL8)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     396880 (CXCL8)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     396880 (CXCL8)    04932 Non-alcoholic fatty liver disease     396880 (CXCL8)    04933 AGE-RAGE signaling pathway in diabetic complications     396880 (CXCL8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssc04052]     396880 (CXCL8)    00536 Glycosaminoglycan binding proteins [BR:ssc00536]     396880 (CXCL8) Cytokines and neuropeptides [BR:ssc04052]  Cytokines   Chemokines    396880 (CXCL8) Glycosaminoglycan binding proteins [BR:ssc00536]  Heparan sulfate / Heparin   Chemokines    396880 (CXCL8) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  396880 NCBI-ProteinID:  NP_999032 Ensembl:  ENSSSCG00000008953 Vega:  OTTSUSG00000001853 UniProt:  P26894 Q68CM2 LinkDB All DBs Position 8:69932646..69935861 Genome browser AA seq 103 aa AA seqDB search MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPH CENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgacttccaaactggctgttgccttcttggcagttttcctgctttctgcagctctctgt gaggctgcagttctggcaagagtaagtgcagaacttcgatgccagtgcataaatacgcat tccacacctttccaccccaaatttatcaaggaactgagagtgattgagagtggaccccac tgtgaaaattcagaaatcattgttaagcttgtcaatggaaaagaggtctgcctggacccc aaggaaaagtgggtgcagaaggttgtacagatatttttgaagagaactgagaagcaacaa caacagcagtaa

DBGET integrated database retrieval system