Sus scrofa (pig): 397033 Help Entry 397033            CDS       T01009                                  Symbol B2M Name (RefSeq) beta-2-microglobulin precursor   KO K08055   beta-2-microglobulin Organism ssc  Sus scrofa (pig) Pathway ssc04612   Antigen processing and presentation ssc05163   Human cytomegalovirus infection ssc05166   Human T-cell leukemia virus 1 infection ssc05168   Herpes simplex virus 1 infection ssc05169   Epstein-Barr virus infection ssc05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:ssc00001]  09150 Organismal Systems   09151 Immune system    04612 Antigen processing and presentation     397033 (B2M)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     397033 (B2M)    05170 Human immunodeficiency virus 1 infection     397033 (B2M)    05168 Herpes simplex virus 1 infection     397033 (B2M)    05163 Human cytomegalovirus infection     397033 (B2M)    05169 Epstein-Barr virus infection     397033 (B2M)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssc04147]     397033 (B2M) Exosome [BR:ssc04147]  Exosomal proteins   Exosomal proteins of breast milk    397033 (B2M) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  C1-set Ig_3 I-set Ig_2 C2-set_3 Cna_B DUF4354 Motif Other DBs NCBI-GeneID:  397033 NCBI-ProteinID:  NP_999143 Ensembl:  ENSSSCG00000004687 UniProt:  Q07717 B2NJ26 Structure PDBPDBj LinkDB All DBs Position 1:complement(126865767..126878501) Genome browser AA seq 118 aa AA seqDB search MAPLVALVLLGLLSLSGLDAVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLL KNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctcccctcgtggccttggtcctgctcgggctgctctcactgtctggcctggatgcg gtcgcgcgtcccccgaaggttcaggtttactcacgccacccagcggaaaacggaaagcca aattacctgaactgctatgtatctgggttccatccgccccagattgaaattgatttgctg aaaaacggggagaagatgaacgcggagcagtcagacctgtctttcagcaaggactggtct ttctaccttctggtccacactgagttcactcctaacgctgtggatcagtatagctgccgc gtgaagcacgtgactctcgataagcccaagatagttaagtgggatcgagaccactaa

DBGET integrated database retrieval system