Sus scrofa (pig): 397468 Help Entry 397468            CDS       T01009                                  Symbol CCK Name (RefSeq) cholecystokinin precursor   KO K05226   cholecystokinin Organism ssc  Sus scrofa (pig) Pathway ssc04080   Neuroactive ligand-receptor interaction ssc04081   Hormone signaling ssc04911   Insulin secretion ssc04972   Pancreatic secretion Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     397468 (CCK)    04081 Hormone signaling     397468 (CCK)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     397468 (CCK)   09154 Digestive system    04972 Pancreatic secretion     397468 (CCK)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssc04052]     397468 (CCK) Cytokines and neuropeptides [BR:ssc04052]  Neuropeptides   GPCR binding    397468 (CCK) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin PGLa-A Motif Other DBs NCBI-GeneID:  397468 NCBI-ProteinID:  NP_999402 Ensembl:  ENSSSCG00000011277 UniProt:  P01356 LinkDB All DBs Position 13:complement(25940674..25945879) Genome browser AA seq 114 aa AA seqDB search MNGGLCLCVLMAVLAAGTLAQPVPPADSAVPGAQEEEAHRRQLRAVQKVDGESRAHLGAL LARYIQQARKAPSGRVSMIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEYEYTS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgaacggcggcttgtgcctgtgtgtgctgatggcggtcctggcggcaggcaccctggcg cagccggtgcctcccgcggactccgcggtccccggggcacaggaggaggaggcgcaccgg cggcagctgagggcggtgcaaaaggtagacggcgagtcccgagcgcacctgggcgcgctg ctggccagatacatccagcaggctcgaaaagcaccttctggccgagtatctatgattaag aatctgcagagcctggaccccagccacagaataagtgaccgggactacatgggctggatg gattttggccggcgcagtgcagaggagtatgaatatacctcctag

DBGET integrated database retrieval system