Sus scrofa (pig): 397581 Help Entry 397581            CDS       T01009                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ssc  Sus scrofa (pig) Pathway ssc04621   NOD-like receptor signaling pathway ssc05012   Parkinson disease ssc05132   Salmonella infection ssc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     397581 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     397581 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     397581 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     397581 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ssc03110]     397581 (TXN) Chaperones and folding catalysts [BR:ssc03110]  Protein folding catalysts   Protein disulfide isomerase    397581 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 DIM1 Thioredoxin_2 OST3_OST6 AhpC-TSA Thioredoxin_9 Thioredoxin_7 Glutaredoxin Redoxin Motif Other DBs NCBI-GeneID:  397581 NCBI-ProteinID:  NP_999478 Ensembl:  ENSSSCG00000005453 UniProt:  P82460 H6TBN0 LinkDB All DBs Position 1:complement(251264180..251278000) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagcaagtacgcttttcaggaagccttgaacagtgcaggagag aaactcgtagtggtcgatttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttcttccattctctctctgaaaagtattccaatgtcgtgttccttgaagtagatgtggat gactgtcaggatgttgcttcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaacaaggaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system