Sus scrofa (pig): 404693 Help Entry 404693            CDS       T01009                                  Symbol CAV1 Name (RefSeq) caveolin-1 isoform b   KO K06278   caveolin 1 Organism ssc  Sus scrofa (pig) Pathway ssc04144   Endocytosis ssc04510   Focal adhesion ssc05020   Prion disease ssc05100   Bacterial invasion of epithelial cells ssc05205   Proteoglycans in cancer ssc05416   Viral myocarditis ssc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     404693 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     404693 (CAV1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     404693 (CAV1)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     404693 (CAV1)   09164 Neurodegenerative disease    05020 Prion disease     404693 (CAV1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     404693 (CAV1)    05416 Viral myocarditis     404693 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     404693 (CAV1) Membrane trafficking [BR:ssc04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     404693 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  404693 NCBI-ProteinID:  NP_999603 UniProt:  Q6RVA9 A0A8D0I8W8 LinkDB All DBs Position 18:complement(29648120..29682451) Genome browser AA seq 147 aa AA seqDB search MAEEMNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTT FTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIY VHTFCDPLFEAIGKIFSNIRINMQKEI NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcagaggaaatgaacgagaagcaagtgtatgacgcgcacaccaaggagatagacttg gtcaaccgcgatcccaagcatctcaacgacgacgttgtcaagattgattttgaagatgtg attgcagaaccagaagggacacacagtttcgatggcatctggaaggccagcttcaccacc ttcactgtgacgaagtactggttttaccgtttgctgtctgccctctttggcatcccaatg gcgctcatctggggcatttactttgccattctctccttcctgcacatctgggccgttgta ccctgcattaagagtttcctgattgagattcagtgcatcagccgtgtctattccatctac gtccacaccttctgtgacccgctctttgaggctattggcaaaatattcagcaatatccgc atcaacatgcagaaagaaatataa

DBGET integrated database retrieval system