Sus scrofa (pig): 406188 Help Entry 406188            CDS       T01009                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism ssc  Sus scrofa (pig) Pathway ssc04024   cAMP signaling pathway ssc04062   Chemokine signaling pathway ssc04064   NF-kappa B signaling pathway ssc04210   Apoptosis ssc04380   Osteoclast differentiation ssc04519   Cadherin signaling ssc04620   Toll-like receptor signaling pathway ssc04621   NOD-like receptor signaling pathway ssc04622   RIG-I-like receptor signaling pathway ssc04623   Cytosolic DNA-sensing pathway ssc04625   C-type lectin receptor signaling pathway ssc04657   IL-17 signaling pathway ssc04658   Th1 and Th2 cell differentiation ssc04659   Th17 cell differentiation ssc04660   T cell receptor signaling pathway ssc04662   B cell receptor signaling pathway ssc04668   TNF signaling pathway ssc04722   Neurotrophin signaling pathway ssc04920   Adipocytokine signaling pathway ssc04926   Relaxin signaling pathway ssc04931   Insulin resistance ssc04936   Alcoholic liver disease ssc05132   Salmonella infection ssc05134   Legionellosis ssc05135   Yersinia infection ssc05140   Leishmaniasis ssc05142   Chagas disease ssc05145   Toxoplasmosis ssc05160   Hepatitis C ssc05161   Hepatitis B ssc05162   Measles ssc05163   Human cytomegalovirus infection ssc05164   Influenza A ssc05166   Human T-cell leukemia virus 1 infection ssc05167   Kaposi sarcoma-associated herpesvirus infection ssc05168   Herpes simplex virus 1 infection ssc05169   Epstein-Barr virus infection ssc05170   Human immunodeficiency virus 1 infection ssc05171   Coronavirus disease ssc05200   Pathways in cancer ssc05203   Viral carcinogenesis ssc05208   Chemical carcinogenesis - reactive oxygen species ssc05215   Prostate cancer ssc05220   Chronic myeloid leukemia ssc05222   Small cell lung cancer ssc05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ssc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     406188 (NFKBIA)    04668 TNF signaling pathway     406188 (NFKBIA)    04024 cAMP signaling pathway     406188 (NFKBIA)   09133 Signaling molecules and interaction    04519 Cadherin signaling     406188 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     406188 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     406188 (NFKBIA)    04621 NOD-like receptor signaling pathway     406188 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     406188 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     406188 (NFKBIA)    04625 C-type lectin receptor signaling pathway     406188 (NFKBIA)    04660 T cell receptor signaling pathway     406188 (NFKBIA)    04658 Th1 and Th2 cell differentiation     406188 (NFKBIA)    04659 Th17 cell differentiation     406188 (NFKBIA)    04657 IL-17 signaling pathway     406188 (NFKBIA)    04662 B cell receptor signaling pathway     406188 (NFKBIA)    04062 Chemokine signaling pathway     406188 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     406188 (NFKBIA)    04926 Relaxin signaling pathway     406188 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     406188 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     406188 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     406188 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     406188 (NFKBIA)    05203 Viral carcinogenesis     406188 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     406188 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     406188 (NFKBIA)    05215 Prostate cancer     406188 (NFKBIA)    05222 Small cell lung cancer     406188 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     406188 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     406188 (NFKBIA)    05161 Hepatitis B     406188 (NFKBIA)    05160 Hepatitis C     406188 (NFKBIA)    05171 Coronavirus disease     406188 (NFKBIA)    05164 Influenza A     406188 (NFKBIA)    05162 Measles     406188 (NFKBIA)    05168 Herpes simplex virus 1 infection     406188 (NFKBIA)    05163 Human cytomegalovirus infection     406188 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     406188 (NFKBIA)    05169 Epstein-Barr virus infection     406188 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     406188 (NFKBIA)    05135 Yersinia infection     406188 (NFKBIA)    05134 Legionellosis     406188 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     406188 (NFKBIA)    05140 Leishmaniasis     406188 (NFKBIA)    05142 Chagas disease     406188 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     406188 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     406188 (NFKBIA)    04931 Insulin resistance     406188 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ssc03000]     406188 (NFKBIA)    04131 Membrane trafficking [BR:ssc04131]     406188 (NFKBIA) Transcription factors [BR:ssc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     406188 (NFKBIA) Membrane trafficking [BR:ssc04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     406188 (NFKBIA) SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  406188 NCBI-ProteinID:  NP_001005150 Ensembl:  ENSSSCG00000001952 Vega:  OTTSUSG00000001063 UniProt:  Q08353 LinkDB All DBs Position 7:64508119..64510754 Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQEWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcccgcagagcccggccaggagtgggccatggaggggccccgggacgcgctc aagaaggagcggctactggatgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctcgagccgcaggaggcgccc cgcggcgccgagccctggaagcagcagctcaccgaggacggagactcgttcctgcacttg gccatcatccatgaagagaaggcactgaccatggaagtggtccgccaagtgaagggagat ctggcttttcttaacttccagaacaacctgcagcagactccactccacttggcggtgatc accaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctccga gactttcgaggaaatacccctctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccgcgggacccagcacctccactccattctgcaggccaccaac tacaatggccacacatgtctgcacttagcctcgatccatggctacctgggcattgtggag ctgttggtgtctttgggtgctgatgtcaacgctcaggagccctgcaatggccgaaccgcc ctgcatcttgcggtggacctgcagaatcccgacctggtgtcgctcttgttgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacctggggccgc ccaagcactcggatacagcagcagctgggccagctgaccctagaaaacctccagatgctt ccagagagcgaggatgaggagagctatgacacggagtcagagttcacagaggatgagctg ccctatgacgactgcgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system