KEGG   Sus scrofa (pig): 445013
Entry
445013            CDS       T01009                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ssc  Sus scrofa (pig)
Pathway
ssc01521  EGFR tyrosine kinase inhibitor resistance
ssc01522  Endocrine resistance
ssc01524  Platinum drug resistance
ssc04010  MAPK signaling pathway
ssc04012  ErbB signaling pathway
ssc04014  Ras signaling pathway
ssc04015  Rap1 signaling pathway
ssc04022  cGMP-PKG signaling pathway
ssc04024  cAMP signaling pathway
ssc04062  Chemokine signaling pathway
ssc04066  HIF-1 signaling pathway
ssc04068  FoxO signaling pathway
ssc04071  Sphingolipid signaling pathway
ssc04072  Phospholipase D signaling pathway
ssc04114  Oocyte meiosis
ssc04140  Autophagy - animal
ssc04148  Efferocytosis
ssc04150  mTOR signaling pathway
ssc04151  PI3K-Akt signaling pathway
ssc04210  Apoptosis
ssc04218  Cellular senescence
ssc04261  Adrenergic signaling in cardiomyocytes
ssc04270  Vascular smooth muscle contraction
ssc04350  TGF-beta signaling pathway
ssc04360  Axon guidance
ssc04370  VEGF signaling pathway
ssc04371  Apelin signaling pathway
ssc04380  Osteoclast differentiation
ssc04510  Focal adhesion
ssc04517  IgSF CAM signaling
ssc04519  Cadherin signaling
ssc04520  Adherens junction
ssc04540  Gap junction
ssc04550  Signaling pathways regulating pluripotency of stem cells
ssc04611  Platelet activation
ssc04613  Neutrophil extracellular trap formation
ssc04620  Toll-like receptor signaling pathway
ssc04621  NOD-like receptor signaling pathway
ssc04625  C-type lectin receptor signaling pathway
ssc04650  Natural killer cell mediated cytotoxicity
ssc04657  IL-17 signaling pathway
ssc04658  Th1 and Th2 cell differentiation
ssc04659  Th17 cell differentiation
ssc04660  T cell receptor signaling pathway
ssc04662  B cell receptor signaling pathway
ssc04664  Fc epsilon RI signaling pathway
ssc04666  Fc gamma R-mediated phagosome formation
ssc04668  TNF signaling pathway
ssc04713  Circadian entrainment
ssc04720  Long-term potentiation
ssc04722  Neurotrophin signaling pathway
ssc04723  Retrograde endocannabinoid signaling
ssc04724  Glutamatergic synapse
ssc04725  Cholinergic synapse
ssc04726  Serotonergic synapse
ssc04730  Long-term depression
ssc04810  Regulation of actin cytoskeleton
ssc04910  Insulin signaling pathway
ssc04912  GnRH signaling pathway
ssc04914  Progesterone-mediated oocyte maturation
ssc04915  Estrogen signaling pathway
ssc04916  Melanogenesis
ssc04917  Prolactin signaling pathway
ssc04919  Thyroid hormone signaling pathway
ssc04921  Oxytocin signaling pathway
ssc04926  Relaxin signaling pathway
ssc04928  Parathyroid hormone synthesis, secretion and action
ssc04929  GnRH secretion
ssc04930  Type II diabetes mellitus
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04934  Cushing syndrome
ssc04935  Growth hormone synthesis, secretion and action
ssc04960  Aldosterone-regulated sodium reabsorption
ssc05010  Alzheimer disease
ssc05020  Prion disease
ssc05022  Pathways of neurodegeneration - multiple diseases
ssc05034  Alcoholism
ssc05132  Salmonella infection
ssc05133  Pertussis
ssc05135  Yersinia infection
ssc05140  Leishmaniasis
ssc05142  Chagas disease
ssc05145  Toxoplasmosis
ssc05152  Tuberculosis
ssc05160  Hepatitis C
ssc05161  Hepatitis B
ssc05163  Human cytomegalovirus infection
ssc05164  Influenza A
ssc05165  Human papillomavirus infection
ssc05166  Human T-cell leukemia virus 1 infection
ssc05167  Kaposi sarcoma-associated herpesvirus infection
ssc05170  Human immunodeficiency virus 1 infection
ssc05171  Coronavirus disease
ssc05200  Pathways in cancer
ssc05203  Viral carcinogenesis
ssc05205  Proteoglycans in cancer
ssc05206  MicroRNAs in cancer
ssc05207  Chemical carcinogenesis - receptor activation
ssc05208  Chemical carcinogenesis - reactive oxygen species
ssc05210  Colorectal cancer
ssc05211  Renal cell carcinoma
ssc05212  Pancreatic cancer
ssc05213  Endometrial cancer
ssc05214  Glioma
ssc05215  Prostate cancer
ssc05216  Thyroid cancer
ssc05218  Melanoma
ssc05219  Bladder cancer
ssc05220  Chronic myeloid leukemia
ssc05221  Acute myeloid leukemia
ssc05223  Non-small cell lung cancer
ssc05224  Breast cancer
ssc05225  Hepatocellular carcinoma
ssc05226  Gastric cancer
ssc05230  Central carbon metabolism in cancer
ssc05231  Choline metabolism in cancer
ssc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ssc05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    445013 (MAPK3)
   04012 ErbB signaling pathway
    445013 (MAPK3)
   04014 Ras signaling pathway
    445013 (MAPK3)
   04015 Rap1 signaling pathway
    445013 (MAPK3)
   04350 TGF-beta signaling pathway
    445013 (MAPK3)
   04370 VEGF signaling pathway
    445013 (MAPK3)
   04371 Apelin signaling pathway
    445013 (MAPK3)
   04668 TNF signaling pathway
    445013 (MAPK3)
   04066 HIF-1 signaling pathway
    445013 (MAPK3)
   04068 FoxO signaling pathway
    445013 (MAPK3)
   04072 Phospholipase D signaling pathway
    445013 (MAPK3)
   04071 Sphingolipid signaling pathway
    445013 (MAPK3)
   04024 cAMP signaling pathway
    445013 (MAPK3)
   04022 cGMP-PKG signaling pathway
    445013 (MAPK3)
   04151 PI3K-Akt signaling pathway
    445013 (MAPK3)
   04150 mTOR signaling pathway
    445013 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    445013 (MAPK3)
   04519 Cadherin signaling
    445013 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    445013 (MAPK3)
   04148 Efferocytosis
    445013 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    445013 (MAPK3)
   04210 Apoptosis
    445013 (MAPK3)
   04218 Cellular senescence
    445013 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    445013 (MAPK3)
   04520 Adherens junction
    445013 (MAPK3)
   04540 Gap junction
    445013 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    445013 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    445013 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    445013 (MAPK3)
   04613 Neutrophil extracellular trap formation
    445013 (MAPK3)
   04620 Toll-like receptor signaling pathway
    445013 (MAPK3)
   04621 NOD-like receptor signaling pathway
    445013 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    445013 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    445013 (MAPK3)
   04660 T cell receptor signaling pathway
    445013 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    445013 (MAPK3)
   04659 Th17 cell differentiation
    445013 (MAPK3)
   04657 IL-17 signaling pathway
    445013 (MAPK3)
   04662 B cell receptor signaling pathway
    445013 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    445013 (MAPK3)
   04666 Fc gamma R-mediated phagosome formation
    445013 (MAPK3)
   04062 Chemokine signaling pathway
    445013 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    445013 (MAPK3)
   04929 GnRH secretion
    445013 (MAPK3)
   04912 GnRH signaling pathway
    445013 (MAPK3)
   04915 Estrogen signaling pathway
    445013 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    445013 (MAPK3)
   04917 Prolactin signaling pathway
    445013 (MAPK3)
   04921 Oxytocin signaling pathway
    445013 (MAPK3)
   04926 Relaxin signaling pathway
    445013 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    445013 (MAPK3)
   04919 Thyroid hormone signaling pathway
    445013 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    445013 (MAPK3)
   04916 Melanogenesis
    445013 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    445013 (MAPK3)
   04270 Vascular smooth muscle contraction
    445013 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    445013 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    445013 (MAPK3)
   04725 Cholinergic synapse
    445013 (MAPK3)
   04726 Serotonergic synapse
    445013 (MAPK3)
   04720 Long-term potentiation
    445013 (MAPK3)
   04730 Long-term depression
    445013 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    445013 (MAPK3)
   04722 Neurotrophin signaling pathway
    445013 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    445013 (MAPK3)
   04380 Osteoclast differentiation
    445013 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    445013 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    445013 (MAPK3)
   05206 MicroRNAs in cancer
    445013 (MAPK3)
   05205 Proteoglycans in cancer
    445013 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    445013 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    445013 (MAPK3)
   05203 Viral carcinogenesis
    445013 (MAPK3)
   05230 Central carbon metabolism in cancer
    445013 (MAPK3)
   05231 Choline metabolism in cancer
    445013 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    445013 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    445013 (MAPK3)
   05212 Pancreatic cancer
    445013 (MAPK3)
   05225 Hepatocellular carcinoma
    445013 (MAPK3)
   05226 Gastric cancer
    445013 (MAPK3)
   05214 Glioma
    445013 (MAPK3)
   05216 Thyroid cancer
    445013 (MAPK3)
   05221 Acute myeloid leukemia
    445013 (MAPK3)
   05220 Chronic myeloid leukemia
    445013 (MAPK3)
   05218 Melanoma
    445013 (MAPK3)
   05211 Renal cell carcinoma
    445013 (MAPK3)
   05219 Bladder cancer
    445013 (MAPK3)
   05215 Prostate cancer
    445013 (MAPK3)
   05213 Endometrial cancer
    445013 (MAPK3)
   05224 Breast cancer
    445013 (MAPK3)
   05223 Non-small cell lung cancer
    445013 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    445013 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    445013 (MAPK3)
   05161 Hepatitis B
    445013 (MAPK3)
   05160 Hepatitis C
    445013 (MAPK3)
   05171 Coronavirus disease
    445013 (MAPK3)
   05164 Influenza A
    445013 (MAPK3)
   05163 Human cytomegalovirus infection
    445013 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    445013 (MAPK3)
   05165 Human papillomavirus infection
    445013 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    445013 (MAPK3)
   05135 Yersinia infection
    445013 (MAPK3)
   05133 Pertussis
    445013 (MAPK3)
   05152 Tuberculosis
    445013 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    445013 (MAPK3)
   05140 Leishmaniasis
    445013 (MAPK3)
   05142 Chagas disease
    445013 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    445013 (MAPK3)
   05020 Prion disease
    445013 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    445013 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    445013 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    445013 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    445013 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    445013 (MAPK3)
   04934 Cushing syndrome
    445013 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    445013 (MAPK3)
   01524 Platinum drug resistance
    445013 (MAPK3)
   01522 Endocrine resistance
    445013 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ssc01001]
    445013 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    445013 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ssc04147]
    445013 (MAPK3)
Enzymes [BR:ssc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     445013 (MAPK3)
Protein kinases [BR:ssc01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   445013 (MAPK3)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     445013 (MAPK3)
Exosome [BR:ssc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   445013 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo Gemini_BL1
Other DBs
NCBI-GeneID: 445013
NCBI-ProteinID: XP_020943678
UniProt: A0A480NH74
LinkDB
Position
3:complement(18291444..18299410)
AA seq 380 aa
MAAAAAAQGGGGGEPRGADGVGPGVPGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSSA
YDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVY
IVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCD
LKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEML
SNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKS
DPKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKER
LKELIFQETARFQPGGLEAP
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggctcaggggggcgggggcggggagccccggggagccgatggg
gtcggccctggggtcccgggggaagtggagatagtaaaggggcagccgttcgacgtgggc
ccgcgctacacgcagctgcaatacatcggcgagggcgcgtacggcatggtcagctcagct
tacgaccatgtgcgcaagactcgagtggccatcaagaaaatcagcccttttgagcatcag
acctactgccagcggaccttgcgagagatccagatcttgctacgcttccgccacgagaac
gtcattggcatccgagacattctgcgggcacccaccctggaagccatgagggatgtctac
attgtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctgagc
aacgaccacatctgctacttcctctaccagatcctgcggggcctcaaatacatccactcc
gccaacgtgctccaccgggatttaaagccctccaacctgctcatcaacaccacctgcgac
cttaagatctgtgactttggccttgcccggatcgcggatcccgagcatgaccacactggc
ttcttgacggaatatgtggccacgcgctggtaccgggccccagagatcatgcttaactcc
aagggctacaccaagtccatagacatttggtctgtgggctgcattctggctgagatgctc
tccaaccggcctatcttcccgggcaagcactacctggaccagctcaaccacattctgggt
atcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaac
tacctgcagtctctgccctccaagaccaaggtggcctgggccaagcttttccccaagtcg
gaccccaaagctcttgacctgctggaccggatgttgacctttaaccccaacaaacggatc
acagtggaggaagcactggctcatccttacctggagcagtactacgacccaacagatgag
ccagtggccgaagagcctttcaccttcgacatggagctggatgatctacccaaggagcgg
ctgaaggaactcatcttccaggaaacagcccgcttccagcccggagggctggaggccccc
taa

DBGET integrated database retrieval system