Sus scrofa (pig): 445453 Help Entry 445453            CDS       T01009                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine 27 precursor   KO K16598   C-C motif chemokine 27 Organism ssc  Sus scrofa (pig) Pathway ssc04060   Cytokine-cytokine receptor interaction ssc04061   Viral protein interaction with cytokine and cytokine receptor ssc04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ssc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     445453 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     445453 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     445453 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssc04052]     445453 (CCL27) Cytokines and neuropeptides [BR:ssc04052]  Cytokines   Chemokines    445453 (CCL27) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 SPRTN_ZBD Motif Other DBs NCBI-GeneID:  445453 NCBI-ProteinID:  NP_001003922 Ensembl:  ENSSSCG00000010967 Vega:  OTTSUSG00000001656 UniProt:  Q8MIG1 LinkDB All DBs Position 10:32138232..32138980 Genome browser AA seq 107 aa AA seqDB search MKGPSPTSSLLLILLLLSPDPGAALILPPSTTCCTELYRQPLSSKLLRQIIRVELQEADG DCHLQAFVLHLSRRSVCIHPQNRSLARWFEHHGRRLQGTLPKLSLGL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaaggggccctcacccactagcagcctcctgctgatactgttgctcctgagcccagat cctggagcagcattgatactgccacccagcactacatgctgtactgagctctaccgacag ccactctcaagcaagctactgaggcagatcatccgggtggaactgcaggaagctgatggg gactgtcacctccaggccttcgtgcttcacctgtctcgacgcagtgtctgcatccacccc cagaaccgcagcctggctcggtggtttgagcaccatggaaggaggctccaggggactctg cccaaactgagtttggggctgtag

DBGET integrated database retrieval system