Sus scrofa (pig): 445532 Help Entry 445532            CDS       T01009                                  Symbol CFL1 Name (RefSeq) cofilin-1   KO K05765   cofilin Organism ssc  Sus scrofa (pig) Pathway ssc04360   Axon guidance ssc04666   Fc gamma R-mediated phagosome formation ssc04810   Regulation of actin cytoskeleton ssc05133   Pertussis ssc05170   Human immunodeficiency virus 1 infection Brite KEGG Orthology (KO) [BR:ssc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     445532 (CFL1)  09150 Organismal Systems   09151 Immune system    04666 Fc gamma R-mediated phagosome formation     445532 (CFL1)   09158 Development and regeneration    04360 Axon guidance     445532 (CFL1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     445532 (CFL1)   09171 Infectious disease: bacterial    05133 Pertussis     445532 (CFL1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssc04131]     445532 (CFL1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ssc04812]     445532 (CFL1)    04147 Exosome [BR:ssc04147]     445532 (CFL1) Membrane trafficking [BR:ssc04131]  Others   Actin-binding proteins    Others     445532 (CFL1) Cytoskeleton proteins [BR:ssc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     ADF / Cofilin      445532 (CFL1) Exosome [BR:ssc04147]  Exosomal proteins   Proteins found in most exosomes    445532 (CFL1) SSDB OrthologParalogGFIT Motif Pfam:  Cofilin_ADF Motif Other DBs NCBI-GeneID:  445532 NCBI-ProteinID:  NP_001004043 UniProt:  P10668 LinkDB All DBs Position 2:<6471558..6475019 Genome browser AA seq 166 aa AA seqDB search MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDV GQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPECAPLKSKMIYASS KDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atggcctccggtgtggctgtctctgacggggtcatcaaagtgttcaatgacatgaaggtg cgtaagtcctcgacaccggaggaggtgaagaagcgcaagaaggcggtgctcttctgcctg agcgaggacaagaagaacatcatcctggaggagggcaaggagatcctcgtgggtgacgtg ggccagactgtagacgacccctatgccacctttgtcaagatgctgccggacaaggactgc cgctatgccctctatgacgccacctacgagaccaaggagagcaagaaggaggacctggtg ttcatcttctgggcccctgagtgtgcacccctgaagagcaaaatgatctacgccagctcc aaggacgccatcaagaagaagctgacagggatcaagcatgaattacaagcgaactgctac gaggaggtcaaggaccgctgcaccctggcagagaagctggggggcagcgccgtcatctcc ctggagggcaagcctttgtga

DBGET integrated database retrieval system