Sus scrofa (pig): 808509 Help Entry 808509            CDS       T01009                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism ssc  Sus scrofa (pig) Pathway ssc00190   Oxidative phosphorylation ssc01100   Metabolic pathways ssc04714   Thermogenesis ssc04723   Retrograde endocannabinoid signaling ssc05010   Alzheimer disease ssc05012   Parkinson disease ssc05014   Amyotrophic lateral sclerosis ssc05016   Huntington disease ssc05020   Prion disease ssc05022   Pathways of neurodegeneration - multiple diseases ssc05208   Chemical carcinogenesis - reactive oxygen species ssc05415   Diabetic cardiomyopathy Module ssc_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:ssc00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     808509 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     808509 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     808509 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     808509 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     808509 (ND4L)    05012 Parkinson disease     808509 (ND4L)    05014 Amyotrophic lateral sclerosis     808509 (ND4L)    05016 Huntington disease     808509 (ND4L)    05020 Prion disease     808509 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     808509 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     808509 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ssc03029]     808509 (ND4L) Enzymes [BR:ssc01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      808509 (ND4L) Mitochondrial biogenesis [BR:ssc03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     808509 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  808509 NCBI-ProteinID:  NP_008642 UniProt:  P56632 Q7IIB8 Structure PDBPDBj LinkDB All DBs Position MT:11069..11365 Genome browser AA seq 98 aa AA seqDB search MPLVYMNIIMAFAIALAGLLMYRSHLMSSLLCLEGMMLSLFIMSTLIILNTHFTLANMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtgccattagtatatataaacatcattatagcattcgcgatcgcccttgcagggttactt atatatcgatctcacttaatatcttcactactatgcctagaaggaatgatactatcacta ttcatcatatcgactctaattatcctaaacacacacttcaccctagctaacataataccc attattttactagtgtttgcagcctgcgaagctgcactaggcctgtcactactagtaata gtatccaacacatacggtaccgattacgtccaaaacttaaaccttttacaatgctaa

DBGET integrated database retrieval system