Staphylococcus schleiferi 1360-13: LH95_07635 Help Entry LH95_07635        CDS       T04012                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssch  Staphylococcus schleiferi 1360-13 Pathway ssch00998   Biosynthesis of various antibiotics ssch01100   Metabolic pathways ssch01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssch00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LH95_07635    00074 Mycolic acid biosynthesis     LH95_07635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LH95_07635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 ACP_SdgA_C Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AKS67327 UniProt:  A0A0K1AEB0 LinkDB All DBs Position complement(1610509..1610742) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEGASFKEDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNYINTLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagacatcattgttgatcgtttaggcgtagacgctgat aaagtaactgaaggtgcatctttcaaagaagatttaggtgcagattcacttgatattgct gaattagtgatggaattagaggatgaatttggtactgaaattccagatgaagaagcggaa aaaatcaacacagttggagacgctgttaattacattaatacacttgaaaaataa

DBGET integrated database retrieval system