Sporothrix schenckii: SPSK_09084 Help Entry SPSK_09084        CDS       T05555                                  Name (RefSeq) Rho family, other   KO K04513   Ras homolog gene family, member A Organism ssck  Sporothrix schenckii Pathway ssck04011   MAPK signaling pathway - yeast ssck04081   Hormone signaling ssck04144   Endocytosis ssck04517   IgSF CAM signaling ssck04519   Cadherin signaling ssck05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ssck00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     SPSK_09084   09133 Signaling molecules and interaction    04081 Hormone signaling     SPSK_09084    04517 IgSF CAM signaling     SPSK_09084    04519 Cadherin signaling     SPSK_09084  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     SPSK_09084  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     SPSK_09084  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssck04131]     SPSK_09084   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssck04147]     SPSK_09084    04031 GTP-binding proteins [BR:ssck04031]     SPSK_09084 Membrane trafficking [BR:ssck04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     SPSK_09084 Exosome [BR:ssck04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SPSK_09084   Exosomal proteins of other body fluids (saliva and urine)    SPSK_09084   Exosomal proteins of colorectal cancer cells    SPSK_09084   Exosomal proteins of bladder cancer cells    SPSK_09084 GTP-binding proteins [BR:ssck04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     SPSK_09084 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  27670941 NCBI-ProteinID:  XP_016588247 UniProt:  A0A0F2MBN4 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCQGLPIILVGCKKD LRYDPKTIEELRKTSQKPVSPEEGEDIRKKIGAYKYLECSAKTNEGVREVFEHATRAALL SRSGKRGSKKSKCTVL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggctgagatccgccggaagctcgtcatcgtcggcgacggtgcctgcggcaagacttgt ttgttgattgttttctccaagggcactttccctgaggtctacgttcccaccgtcttcgag aactatgtcgcggatgttgaggtcgatggcaagcacgtcgagctggccctctgggatacg gctggccaggaggactacgaccggttgcgccctctgtcctaccccgactcgcacgtcatt ctgatctgcttcgctgtcgactcgcctgactcgctcgacaacgtccaggagaagtggatc tccgaggttctgcacttctgccagggtctgcccatcattctggttggctgcaagaaggat ctccgctacgaccccaagaccatcgaggagctgcgcaagacgagccaaaagcccgtctcg ccggaggagggtgaggacatccgcaagaagattggtgcctacaagtaccttgagtgctct gccaagaccaacgagggcgttcgcgaggtgtttgagcacgctacccgcgctgctctgctc tcgcgcagcggcaagagagggagcaagaagagcaagtgcacggttctgtaa

DBGET integrated database retrieval system