Syngnathus scovelli (Gulf pipefish): 125966768 Help Entry 125966768         CDS       T08785                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv03030   DNA replication sscv03082   ATP-dependent chromatin remodeling sscv03410   Base excision repair sscv03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:sscv00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     125966768 (pole3)    03410 Base excision repair     125966768 (pole3)    03420 Nucleotide excision repair     125966768 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125966768 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sscv03032]     125966768 (pole3)    03036 Chromosome and associated proteins [BR:sscv03036]     125966768 (pole3)    03400 DNA repair and recombination proteins [BR:sscv03400]     125966768 (pole3) Enzymes [BR:sscv01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      125966768 (pole3) DNA replication proteins [BR:sscv03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     125966768 (pole3) Chromosome and associated proteins [BR:sscv03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     125966768 (pole3) DNA repair and recombination proteins [BR:sscv03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       125966768 (pole3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C CIS_TMP DUF5427 DUF3276 DUF4746 SpoU_methylase RNA_pol_3_Rpc31 Thg1C V_ATPase_I Motif Other DBs NCBI-GeneID:  125966768 NCBI-ProteinID:  XP_049573160 LinkDB All DBs Position 4:7451100..7454168 Genome browser AA seq 148 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNGGDVLAAMEEMEFERFMKPLREALEVYKKGQKGKKEVSEQKRKDKEKKTDSENDK SREEEEEEEHMDEEPEGENEVEEEEVEN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaggccagaagatctcaaccttcccaacgcggtcatcacccgaatcatcaaa gaggcgctcccagatggggtaaatgtgtcaaaagaagcacggagagcaatatcccaagct gccagtgtgtttgtgttgtatgcaacatcttgtgcaaacaactttgccatgaaagccaag cgaaaaactctgaatggaggcgacgtcttagctgcaatggaggaaatggagtttgaacgg tttatgaagcctcttcgagaagctttggaagtttataagaagggccaaaagggaaagaag gaggtgtcagagcagaagcgcaaagataaagaaaagaagacagactctgaaaatgataag agtcgggaggaggaagaggaggaggaacacatggatgaagaacctgaaggagagaatgag gtggaggaagaggaggtggaaaactga

DBGET integrated database retrieval system