Syngnathus scovelli (Gulf pipefish): 125970651 Help Entry 125970651         CDS       T08785                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04010   MAPK signaling pathway sscv04012   ErbB signaling pathway sscv04068   FoxO signaling pathway sscv04137   Mitophagy - animal sscv04140   Autophagy - animal sscv04144   Endocytosis sscv04150   mTOR signaling pathway sscv04210   Apoptosis sscv04218   Cellular senescence sscv04370   VEGF signaling pathway sscv04371   Apelin signaling pathway sscv04510   Focal adhesion sscv04540   Gap junction sscv04625   C-type lectin receptor signaling pathway sscv04810   Regulation of actin cytoskeleton sscv04910   Insulin signaling pathway sscv04912   GnRH signaling pathway sscv04916   Melanogenesis sscv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sscv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125970651    04012 ErbB signaling pathway     125970651    04370 VEGF signaling pathway     125970651    04371 Apelin signaling pathway     125970651    04068 FoxO signaling pathway     125970651    04150 mTOR signaling pathway     125970651  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125970651    04140 Autophagy - animal     125970651    04137 Mitophagy - animal     125970651   09143 Cell growth and death    04210 Apoptosis     125970651    04218 Cellular senescence     125970651   09144 Cellular community - eukaryotes    04510 Focal adhesion     125970651    04540 Gap junction     125970651   09142 Cell motility    04810 Regulation of actin cytoskeleton     125970651  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125970651   09152 Endocrine system    04910 Insulin signaling pathway     125970651    04912 GnRH signaling pathway     125970651    04916 Melanogenesis     125970651  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125970651  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sscv04131]     125970651   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sscv04147]     125970651    04031 GTP-binding proteins [BR:sscv04031]     125970651 Membrane trafficking [BR:sscv04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     125970651  Endocytosis   Macropinocytosis    Ras GTPases     125970651 Exosome [BR:sscv04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    125970651   Exosomal proteins of colorectal cancer cells    125970651 GTP-binding proteins [BR:sscv04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     125970651 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  125970651 NCBI-ProteinID:  XP_049579148 LinkDB All DBs Position 6:complement(12138558..12153398) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtacaagctggtggtggtgggcgctggaggcgtgggcaagagtgcactcacc atccaactcatccagaaccactttgtggatgaatatgaccccaccatagaggactcgtac aggaaacaagttgtgattgacggagagacctgcttgctggacatcctggatactgcaggt caggaggaatacagcgcaatgagggaccagtacatgaggacgggagagggattcctctgc gtgttcgcaatcaacaacacaaaatcctttgaagacattcatcaatacagagaacagatt aaacgcgtaaaggactcggatgatgttcccatggtgcttgtgggcaacaaatgtgacctc cctgcacgtacggtggacacaaggcaagcccaggaactcgcacgttcctatggcatccct tacattgaaacctctgctaagacacgacagggagtagaggatgctttctacacactggtc agggaaattaggcaacacaagctgaggaagctgaatccgccagatgaaagtggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system